KEGG   Mycoplasma leachii PG50: MSB_A0781Help
Entry
MSB_A0781         CDS       T01367                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mlc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mlc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mlc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mlc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850300..851046
Genome map
AA seq 248 aa AA seqDB search
MKKKVIFGNWKMNGTNESLTDFLNQVDNKVDSSKIIAGLAVPYVMLQTGLKLAKNVKIAA
QNVHYKDKGAYTGEISTTMLKEIGVEYVIIGHSERREMFNETDLDVNKKAKVLLENNITP
IICCGETLQTKESGKTIEFVNNQINIMFEGIKKEDAIKAIIAYEPIWAIGTGKTATSSDA
EEVCKQIRNNLAKIYDKNTAEQIIIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLASDY
LGLVNYNE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggtaatttttggtaattgaaaaatgaatgggactaatgaaagtttgaca
gattttttaaaccaagtagataataaagtagatagttcaaaaattatagcaggattagct
gtaccttatgtaatgttacaaactgggctaaaacttgcaaaaaatgttaaaatagctgct
caaaacgtacattataaagataagggtgcttatactggagaaatttcaactacaatgcta
aaagaaattggagttgaatatgtaattattggacattctgaaagaagagaaatgtttaat
gaaactgatttagatgttaataaaaaggctaaagttttattagaaaacaatataactcca
attatttgttgtggtgaaactttacaaactaaagaaagtggaaaaactattgaatttgta
aataatcaaattaatataatgtttgaaggtattaaaaaagaagatgcaatcaaagcaatt
attgcttatgaaccaatttgagcaattggtactggaaaaacagcaacaagtagtgatgct
gaagaagtatgcaaacaaatcagaaataatttagcaaaaatttatgataaaaatacagct
gaacaaattattattcagtatggtggaagtgttaaaccatcaaatattcaagaatattta
aaaatgccaaatattgatggagctttagttgggggagcttctttattagctagtgattat
ttaggtttagttaactataatgaataa

DBGET integrated database retrieval system