KEGG   Mycoplasma leachii PG50: MSB_A0781Help
Entry
MSB_A0781         CDS       T01367                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mlc  Mycoplasma leachii PG50
Pathway
mlc00010  Glycolysis / Gluconeogenesis
mlc00051  Fructose and mannose metabolism
mlc01100  Metabolic pathways
mlc01110  Biosynthesis of secondary metabolites
mlc01120  Microbial metabolism in diverse environments
mlc01130  Biosynthesis of antibiotics
mlc01200  Carbon metabolism
mlc01230  Biosynthesis of amino acids
Module
mlc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mlc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mlc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSB_A0781 (tpiA)
   00051 Fructose and mannose metabolism
    MSB_A0781 (tpiA)
   00562 Inositol phosphate metabolism
    MSB_A0781 (tpiA)
Enzymes [BR:mlc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSB_A0781 (tpiA)
Exosome [BR:mlc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSB_A0781 (tpiA)
  Exosomal proteins of bladder cancer cells
   MSB_A0781 (tpiA)
  Exosomal proteins of melanoma cells
   MSB_A0781 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Aldolase Terminase_3 MeMO_Hyd_G
Motif
Other DBs
NCBI-ProteinID: ADR24447
UniProt: E4PSI3
Position
850300..851046
Genome map
AA seq 248 aa AA seqDB search
MKKKVIFGNWKMNGTNESLTDFLNQVDNKVDSSKIIAGLAVPYVMLQTGLKLAKNVKIAA
QNVHYKDKGAYTGEISTTMLKEIGVEYVIIGHSERREMFNETDLDVNKKAKVLLENNITP
IICCGETLQTKESGKTIEFVNNQINIMFEGIKKEDAIKAIIAYEPIWAIGTGKTATSSDA
EEVCKQIRNNLAKIYDKNTAEQIIIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLASDY
LGLVNYNE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggtaatttttggtaattgaaaaatgaatgggactaatgaaagtttgaca
gattttttaaaccaagtagataataaagtagatagttcaaaaattatagcaggattagct
gtaccttatgtaatgttacaaactgggctaaaacttgcaaaaaatgttaaaatagctgct
caaaacgtacattataaagataagggtgcttatactggagaaatttcaactacaatgcta
aaagaaattggagttgaatatgtaattattggacattctgaaagaagagaaatgtttaat
gaaactgatttagatgttaataaaaaggctaaagttttattagaaaacaatataactcca
attatttgttgtggtgaaactttacaaactaaagaaagtggaaaaactattgaatttgta
aataatcaaattaatataatgtttgaaggtattaaaaaagaagatgcaatcaaagcaatt
attgcttatgaaccaatttgagcaattggtactggaaaaacagcaacaagtagtgatgct
gaagaagtatgcaaacaaatcagaaataatttagcaaaaatttatgataaaaatacagct
gaacaaattattattcagtatggtggaagtgttaaaccatcaaatattcaagaatattta
aaaatgccaaatattgatggagctttagttgggggagcttctttattagctagtgattat
ttaggtttagttaactataatgaataa

DBGET integrated database retrieval system