KEGG   Mycoplasma leachii PG50: MSB_A0901Help
Entry
MSB_A0901         CDS       T01367                                 

Gene name
bgl
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:mlc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSB_A0901 (bgl)
Enzymes [BR:mlc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MSB_A0901 (bgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980275..981663
Genome map
AA seq 462 aa AA seqDB search
MFKFKKDFWWGAASSGCQTESDKDKPNLNIMDYWYKQTPTDFYDNKGPNITCDTYSNYKT
DVKLMSEIGLNSFRTSIQWTRLIKNLYTGEVDLKQVEFYRNYFLEIKKNNIKLIVNLFHF
DTPIELENIGGWTNKKTVELYFLYAKQCFKYFSDLVDYWTTFNEPIVLVDGCYLNKWYYP
KISNLKLAIQAAYNTILAHCKVANYFHSYFKNDQNKKISIILNLTPTIPKNSESKHLKAA
KIRDELLNKSFLNAVIKGQFSNFLIKFLNENNLMPEYDQLELNEIKKTRIDFLAVNYYQP
ARVQAPNNNLDNPKDLKLENWFEVYVDKKSRINPYRGWEIHPQTLYDIAIDIKNNYDNIP
WIVSENGIGVSDENRFLNKQGYIDDQYRIDFIKEHLIYLYKAIEQGSNCFGYHMWTLIDN
WSWANGFKNRYGFISLDTKTLKRTIKKSGYWIKQVIKDQGFE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttaaaaaagatttttggtgaggtgctgctagttctgggtgtcagactgaa
tcagataaagataaaccaaatttaaatattatggattattgatacaaacaaacaccaaca
gatttttatgataataaaggacctaatattacttgcgatacttattctaactataaaact
gatgttaaattaatgagtgaaattggattaaacagttttagaacttctattcaatgaaca
agattaataaaaaatttatatacaggtgaagttgatttaaaacaagtagagttttataga
aattattttttagaaattaaaaaaaataatattaaattaattgttaatttatttcatttt
gatacacctattgaattagaaaatattggtggttgaactaataaaaaaacagtagaatta
tattttttatatgctaaacaatgttttaaatattttagtgatttagttgattattgaaca
acatttaatgaacctatagttttagtagatggatgttatttaaataagtgatattatcca
aaaattagtaacttaaaattagcaattcaagcagcatacaacacaatactagctcattgc
aaagtagctaattattttcattcttattttaaaaatgatcaaaataaaaaaatatcaata
atattaaatcttactccaacaataccaaaaaatagtgaatcaaaacatttaaaagcagca
aaaattagagatgaattacttaataaatcttttttaaatgcagttataaaaggacaattt
agtaattttttaatcaaatttttaaatgaaaataatttaatgcctgaatatgatcaatta
gaattaaatgaaattaaaaaaacaagaattgattttttagctgtgaattattatcaacca
gcaagagtacaagcaccaaacaataatttagataacccaaaagatttaaaactagaaaat
tgatttgaagtatatgttgataaaaaaagtagaattaatccttatagaggttgagaaatt
cacccacaaacactatatgatatagctatagatattaaaaataattatgataatatacct
tgaatagtttcagaaaatggaattggtgtgagtgatgaaaataggtttttaaacaaacaa
ggttatattgatgatcaatatcgtatagattttataaaagaacatttaatttatttatat
aaagcaatagaacaaggttcaaattgttttggttatcatatgtgaacattaattgataat
tgaagctgagctaatggttttaaaaatagatatggttttataagtttagatacaaaaaca
ttaaaaagaacaattaaaaaatcaggttattgaattaaacaagtaattaaagatcaagga
tttgaataa

DBGET integrated database retrieval system