KEGG   Mycoplasma leachii PG50: MSB_A0910Help
Entry
MSB_A0910         CDS       T01367                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mlc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988868..989803
Genome map
AA seq 311 aa AA seqDB search
MIYTITLNPAIDCVIETNEIDFNNTNYYTNSYSLIGGKGINVAIILNNLKNDVISTGFLG
KNNANQFLDKFLKLNLKNHFFLYNGITRTNFKIKNLNTFDEIELNGVGCDLKSSYLNKLL
KYLKDNLKENDIVIASGSVNKSFNDNVYQIIGDLVNKKQALFILDTSKKYLLEGLKAKPF
LIKPNISELFSVFNEPISYEFDEICKKIKQLQNLGARNILLSMANKGSYYFSENNDIYKI
GVGQGKLVNSTGAGDSMLAGFVHGLNQQLDIIKTLKYAASCGSSTAFSKWLATKKEINKH
LKEIKVKKIER
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacaattactttaaaccctgctattgattgtgtaattgaaactaatgaaata
gattttaataacactaattattatacaaatagttattcattaattggtggtaagggaatt
aatgtagcaattattttaaataatttaaaaaatgatgttataagtacaggttttttaggt
aaaaataatgccaatcaatttttagataaatttttaaaattgaatttaaaaaatcatttc
tttttatacaatggtataactagaactaattttaagattaaaaatttaaatacttttgat
gaaatagagctgaatggtgtcggttgtgatcttaaatcaagttatctaaataagttatta
aaatatcttaaagataatttaaaggaaaatgatattgttatagctagtggaagtgttaat
aaatcatttaatgataatgtttatcaaattataggtgatcttgttaataaaaaacaagct
ttattcattttagatacctctaaaaaatatcttttagaaggtctaaaagcaaaacctttt
ttaattaaaccaaacattagtgaattattttcagtttttaatgaacctattagttatgaa
tttgatgaaatttgtaaaaaaataaagcaactacaaaatttaggtgctagaaatatttta
ttaagtatggcaaataaaggaagctattatttttcagaaaacaatgatatttataaaata
ggggttggtcaaggaaaactagttaattcaactggagctggtgattcaatgttagctgga
tttgttcacggattaaatcaacaattagatattataaaaactttaaaatatgctgctagc
tgcgggtcaagtactgcttttagtaaatgactagcaacaaaaaaagaaatcaataaacac
ttaaaagaaattaaagttaaaaaaatagaaaggtag

DBGET integrated database retrieval system