KEGG   Mycoplasma leachii PG50: MSB_A0918Help
Entry
MSB_A0918         CDS       T01367                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mlc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999396..999896
Genome map
AA seq 166 aa AA seqDB search
MKSQNKNKALIIVDYQYDFCDPNGSLYVKNAYTLKSKIEKLAKDLKSQGWTIIATKDFHP
IDHCSFKIWNKHCIQNTKGSELYFDHSDVDLIIEKGVNKDIESYSGFFDDANNSNGLDEY
LKSKNIDTLKIVGVATEICVKANYDDAIKLGYDVEVDLEYCKGFTD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacaaaataaaaataaggcattaattatagttgattatcaatatgatttttgt
gatcctaatggtagtttatatgtaaaaaacgcctacacactaaaatctaaaattgaaaaa
ttagcaaaagacttaaaatctcaaggttgaacaattattgcaactaaagattttcatcca
attgatcattgttcttttaaaatttgaaataaacattgtatacaaaatactaaaggtagt
gaactttattttgatcatagtgatgttgatttaattattgaaaaaggtgttaataaagat
attgaaagctatagcggtttttttgatgatgctaataactcaaatgggttagatgagtat
ttaaaatcaaaaaacatagacactttaaaaatagttggtgttgctactgaaatttgtgta
aaagctaattatgatgatgctattaaattaggttatgatgttgaggttgatttagaatat
tgtaaaggttttactgactag

DBGET integrated database retrieval system