KEGG   Mycobacterium leprae TN: ML0120Help
Entry
ML0120            CDS       T00047                                 

Gene name
echA1
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mle  Mycobacterium leprae TN
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ML0120 (echA1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ML0120 (echA1)
   00650 Butanoate metabolism
    ML0120 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    ML0120 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ML0120 (echA1)
   00310 Lysine degradation
    ML0120 (echA1)
   00360 Phenylalanine metabolism
    ML0120 (echA1)
   00380 Tryptophan metabolism
    ML0120 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML0120 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ML0120 (echA1)
   00281 Geraniol degradation
    ML0120 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ML0120 (echA1)
   00627 Aminobenzoate degradation
    ML0120 (echA1)
   00930 Caprolactam degradation
    ML0120 (echA1)
Enzymes [BR:mle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ML0120 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(161741..162577)
Genome map
AA seq 278 aa AA seqDB search
MGSDINRAYESVAVEIKDRVAQVTLIGPGKGNAMGPAFWSEMPEVFAELDTNREVRAVVI
TGSGKDFSYGLDVPAMGGKFVPLLTDGALARPRTDFHAEVLRMQKAINAVADCRTPTIAA
VHGWCIGGALDLISAVDIRYASADAKFSMREVKLAIVADMGSLARLPLILSDGHLRELAL
TGKDIDATRAEKIGLVNDVYDNADKTLAAAHATAAEIAANPPLAVYGVKDVLYQQRTSAI
SESLRYVAAWNAAFLPSKDLTEGISATFAKRAPQFIGE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgggctcagacataaatcgggcatatgaatccgttgccgtcgaaatcaaagatcgggtt
gcacaggtaacactgatcgggccaggcaagggcaacgcgatggggccggccttctggtcg
gagatgccggaggtgttcgcagagctagataccaaccgtgaggtacgggccgtcgtcatc
accggatcaggaaaagattttagctacggcctggacgtgcccgcgatgggcggaaagttc
gtcccattgctgaccgacggcgcactggcacgcccccgcaccgacttccacgccgaagtg
ctgcggatgcagaaggcgataaacgccgtcgctgattgccgcacgcccacgatcgcggcg
gtgcacggctggtgcattggtggcgctttagacctgatctccgcggtcgatatccgctac
gccagcgccgacgccaagttctcaatgcgggaagtcaaactggccatagtcgccgacatg
ggcagtctcgcccgccttccactgatcttgagcgacgggcatctgcgtgaactggcgttg
acgggaaaagacatcgacgcgacccgcgccgagaaaattggccttgtaaatgatgtctac
gacaatgccgacaagacgctggctgccgcccatgccaccgctgccgagatcgccgccaac
ccgccactagcggtctacggcgtcaaggatgtcctttaccaacaacgcacctccgcgatc
tcagagagcctacgctacgtcgctgcgtggaacgcggcctttctgccgtccaaggatctg
accgagggcatatcggccacgttcgccaagcgggcaccgcagttcatcggggagtag

DBGET integrated database retrieval system