KEGG   Mycobacterium leprae TN: ML0182Help
Entry
ML0182            CDS       T00047                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mle  Mycobacterium leprae TN
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ML0182 (galU)
   00052 Galactose metabolism
    ML0182 (galU)
   00500 Starch and sucrose metabolism
    ML0182 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ML0182 (galU)
Enzymes [BR:mle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ML0182 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
247094..248014
Genome map
AA seq 306 aa AA seqDB search
MSLLLSAQVPIPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAER
LVIVTSEGKDGVVAHFVQDLVLEGTLLARGNKAMLAKVRRAPELIKVESVVQAEPLGLGH
AIGCAEPTLAPDEDAVSVLLPDDLVLPTGVLETMSKVRASRGGTVLCAIEVASEEISSYG
VFDVEPVPGGDNPNVLKVIGMVEKPKAEDAPSTFAAAGRYVLDRAIFDALRRVSRGTGGE
VQITDAIALLIKEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVER
LGLIEQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcctcctaagcgcgcaagtcccgatcccattcactgcgatcgttcctgcggcc
ggtctgggcactcgtttcttgccagcaaccaaaacggtgcccaaagagctactacccgtc
gtcgacacccccggtatcgagttggttgcagccgaggccgctgcggccggggccgaacgt
ctggtgattgtcacctccgaaggcaaggatggggtggtcgctcatttcgtccaagacttg
gtgctagagggcacgctgttggcacgcggcaacaaagccatgttagccaaggtgcgtcgt
gcgccggagttaatcaaagtggaatccgtcgtgcaggctgagccgctaggactgggacat
gctatcggctgcgcggagcccacactggcgccggatgaggatgctgtgtcggtgttgctg
cccgatgacttggtattgccgactggcgtgctggagacgatgtcgaaggtgcgggccagc
cgcggcggtacagtgttgtgtgccatcgaggtggcatcagaagagatcagctcatacggg
gttttcgacgtcgagccggttcccggcggggacaatcctaacgtgttgaaggttatcggc
atggtggaaaagcccaaagccgaagatgctccttcgacgttcgcggcagccggtcgctat
gtgcttgatcgcgcaattttcgatgcgttgcgtcgcgtcagtcgtggcacaggcggcgag
gtgcagatcaccgatgcgatcgcgttgctaatcaaggagggccatccggtccacgtagtg
gtgcatcgcggatctcgacacgacttgggaaatcccggcggctacctgaaagctgcggtt
gactttgcgttggatcgtgacgattatggcccggatttgcggcggtggttggtggagcga
ttgggtttaatcgagcagtag

DBGET integrated database retrieval system