KEGG   Mycobacterium leprae TN: ML0242Help
Entry
ML0242            CDS       T00047                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mle  Mycobacterium leprae TN
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mle00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
317042..317977
Genome map
AA seq 311 aa AA seqDB search
MPTGSVTVQVPGKINLYLAVGDCCDNGYHELVTVFHAVSLVDQVTVRNADVLSLGLVGEG
ANHVPTDEHNIAWRAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSL
WELSLPRRDLCMLAAKLGSDVPFALHGGTALGTGRGEELATVLSRATFHWVLAFADSSLL
TPAVYTEFDRLRDVGNPPRLAEPGPVLAALVAADPEQLAPLLGNELQAAAVSLDPALRCA
LRAGMEAGALAGIVSGSGPTCAFLCASATSAIDVGAQLAGAGVCRTVRVATGPVPGARVV
HAPMSRGLNDM
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgggtcggtcaccgttcaggttcccgggaagatcaatctctacctcgctgtc
ggtgattgctgcgataatggctaccacgagctggtgacggttttccatgctgtgtcgctg
gtcgaccaggttacggtgcgcaacgccgacgtgctgtcgctcggacttgtcggcgagggc
gccaaccacgtgcccactgacgaacacaacattgcctggcgggcggccgagctaatggcc
gagcacgttggccgggctccggacgtttcgatcatgattgacaagtccattccggtggct
ggggggatggcgggcggcagcgccgatgcggccgcggtgttggttgcgatgaactcgttg
tgggaactcagcctgcctcgacgcgatctgtgcatgctcgcagcgaagctaggcagcgac
gtgccgttcgcactacacggtggtaccgcgctggggaccggtcgcggtgaggagctagct
accgtgttgtcccgcgccactttccactgggtgttggcgttcgccgacagcagtttgctc
actccggcggtgtacaccgagtttgaccggctcagggatgtcggaaatccaccacggctt
gccgaacccgggccggtgttggccgccctggtcgccgccgatcccgaacagttggcgccg
ttgctaggcaatgaattgcaagcggccgcggtcagcttggacccggcgctacggtgtgcg
ctccgcgccggtatggaagcgggtgcgctcgcgggcattgtgtctggctcgggtcctacc
tgcgcattcctgtgtgcctcggcgacttcggcgatcgatgtcggtgcgcagttggcaggg
gcgggtgtctgtcgcactgttcgggtcgccaccggaccagtacccggtgctcgggtggta
catgcgcccatgagccgaggtctgaatgacatgtga

DBGET integrated database retrieval system