KEGG   Mycobacterium leprae TN: ML0280Help
Entry
ML0280            CDS       T00047                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase (EC:6.3.4.4)
  KO
K01939  
adenylosuccinate synthase [EC:6.3.4.4]
Organism
mle  Mycobacterium leprae TN
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ML0280 (purA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ML0280 (purA)
Enzymes [BR:mle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     ML0280 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(361950..363248)
Genome map
AA seq 432 aa AA seqDB search
MPAVVLIGAQWGDEGKGKVTDLLGGRAQWVVRYQGGNNAGHTVVLPTGENFTLHLIPSGV
LTPGVTNVIGNGVVVDPGVLLSELQGLEDRGVDTSQLLISADAHLLMPYHVAIDKVTERY
MGNKKIGTTGRGIGPCYQDKIARMGIRVADVLEPGELTHKIEAALEFKNQVLVKIYNRKA
LDLAQVVETLLEQAQQFRHRITDTRLLLNDALEAGETVLLEGAQGTLLDVDHGTYPYVTS
SNPTAGGAALGSGIGPTRIHTVLGILKAYTTRVGSGPFPTELFDENGEYLAKTGSEIGVT
TGRRRRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLETVPVCVGYQIAGVRTHDMPIT
QSDLARAEPIYEELPGWWEDISGAREFEDLPAKARDYVLRLEELAGAQVACIGVGPGRDQ
TIVRCDVLRSRR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccggcagtcgtcctcatcggcgctcagtggggcgacgagggcaaaggtaaggtcaca
gacctgctcggcggacgtgcccagtgggtggtgcgctatcagggtggcaataacgctggg
cataccgttgtcttgcctactggcgagaacttcacactgcatctgatcccgtcgggggtg
ctgacgccgggtgttaccaacgtcatcggtaacggtgtggtggtggatcccggagtgctg
ctcagcgaactgcaaggcctggaagatcgtggtgtcgacacctcccagctgctgatctca
gccgatgcgcacctgctgatgccctaccacgtggccatcgacaaggtcaccgagcgttac
atgggcaacaagaagatcggcactaccggccgcggtatcgggccctgttaccaggacaag
atcgcccgcatggggatacgggtcgccgatgtcttagaacctggtgagttgacccacaag
atcgaggctgcgctcgagttcaaaaaccaggtgttggtcaagatctacaaccgcaaggcg
ttggacctggctcaggttgtcgaaacgctgctggagcaggcgcagcaatttcgacatcgc
atcaccgacactcgtctgttgctcaacgacgccctcgaggccggtgagacggtgctgctt
gaaggcgcacaaggcaccctgctcgacgttgatcacggcacctacccgtatgtgacatcg
tcgaatccgacggcgggcggtgcggcgttgggctccggtatcggaccgacccggatccac
actgtgctaggcattctcaaggcctacactactcgggtgggttctggtcctttccctacc
gaactgttcgacgagaacggcgagtacttggccaagactggtagcgagatcggcgtgacg
acaggacgacggcggcgttgcgggtggttcgacgccgtgatagcccgctacgccacccgg
gtcaacgggatcaccgactatttcctgaccaagcttgacgtgctgtccagcttggaaacg
gtgccggtctgcgtcggctatcagatcgccggtgtgcgcacccacgatatgccgataacc
caaagcgatctcgcccgtgccgagccgatctatgaggagctgccgggttggtgggaagac
atctccggagcgcgggaattcgaggacctgcccgccaaagcgcgtgactacgtattgaga
ctggaagaacttgctggagcacaggttgcgtgcataggtgtcggtccgggacgggatcag
accatcgtgcgatgcgatgtattgaggagccgtcggtga

DBGET integrated database retrieval system