KEGG   Mycobacterium leprae TN: ML0389Help
Entry
ML0389            CDS       T00047                                 

Gene name
choD
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mle  Mycobacterium leprae TN
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ML0389 (choD)
Enzymes [BR:mle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ML0389 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
483451..485160
Genome map
AA seq 569 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAKTSWDLRKFLWAPKL
GCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPFFANQQWAHITDWHSELAPHY
DQAQRMLGVVCNPTFTDADRILKEVVDEMGFGDTFVPTPVGVFFGPDGTQTPGRTVADPY
FGGVGPVRTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTTVKGFELRSEGL
WEVHTVRTGSWLRRGRRTFTAAHLLLAAGTWGTQRLLFRMRDQGKLPRLSQRLGVLTRTN
SESIVGAGTLNVMPDRDLTHGVAITSSIHPTSDTHIEPIRYGKGSNAMGLLQTLMTDGPG
PEGTDVPRWRQLLHQASEDPRRMLRLINPRRWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGNGEPNPSWIPIGNEVTRRLAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGDN
AEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLWPNKGQHDQRPR
QGESYRRLAPIAPDHPVVPAEALGALRWL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattatgacgtcttaatcatcggttcagggtttggcggcagtgtcagtgcg
ctgcggctcacggaaaaaggttaccgggtcggtgttttggaggcgggccgtcgcttcgcc
gacgaggattttgccaagacgtcctgggatctgcgtaaattcctctgggcgccgaagctg
ggctgctacggcatccaacgcattcacctgctgcgcaacgtgatgatattggccggcgcc
ggagtgggaggcggttcgttgaactacgcgaatacgttgtacgttccgccggagccgttc
tttgccaaccagcagtgggcgcacatcaccgactggcacagcgagctggcgccgcattac
gaccaggcgcagcggatgttaggtgtggtttgtaacccgaccttcaccgacgccgaccgg
atactcaaagaggttgtcgatgagatggggtttggcgacacctttgtgccgacgccggtg
ggggtgtttttcggccctgatggcactcagacgccgggtcggaccgtggccgacccgtat
ttcggcggcgtggggccagtgcgcaccggctgcctggaatgtggttgctgtatgacgggt
tgtcgccacggtgccaagaacacgttggtgaaaaattaccttggtctagcggaatcagca
ggtgcgcaagtgattccgatgacgacggtgaaaggattcgaactgcggtccgaggggctg
tgggaagttcatacggtccgcaccggcagttggctgcgcaggggcagacgcacgtttacc
gctgcacacctgctgctggccgccggcacgtgggggacgcaacgtttgctgttcaggatg
cgtgaccaaggtaagttgcctcgtctgtcgcagcgcttgggtgtgttgactcggacaaac
tcggagtcgattgtcggtgctgggaccttgaacgtcatgcctgaccgggacctgacgcat
ggcgtggcgatcacgtcgtcgattcacccgacgtcggacacgcatatcgaacccatacgc
tacggcaaggggtccaacgcgatgggattgttgcagaccttgatgactgacgggcccggt
cccgagggcaccgatgtgccgcgctggaggcagttattgcatcaggccagcgaagatccg
cgccgcatgctgcggctgattaatccccgtcggtggagcgaacgcacggtgatcgcgttg
gtgatgcagcacttggataactcgatcaccacgtttaccaagcgggggaaactgggcatc
cgttggtactccagcaaacaggggaacggagaaccgaacccgtcgtggatcccgatcggc
aacgaggtcacccgccgtctagccgccaagatcgacggcgtggccggcggtacctggggc
gagcttttcaacatcccgctgaccgcgcactttcttggcggtgcggtgattggcgacaac
gctgaacacggggtgatagacccctaccatcgagtctacggctatcctacactgtacgtg
gtggacggcgcagcgatttcggcgaacctgggcgtcaacccatcgttgtctatcgctgcg
caagctgagcgtgcagcctccttgtggcccaacaagggccagcacgatcagcgccctcgg
cagggtgagtcgtaccgtcggctggccccgatcgccccggaccacccggtggtgcccgcc
gaagcgctgggagcgctgcggtggctatag

DBGET integrated database retrieval system