KEGG   Mycobacterium leprae TN: ML0482Help
Entry
ML0482            CDS       T00047                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mle  Mycobacterium leprae TN
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mle00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ML0482 (ruvA)
Enzymes [BR:mle01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ML0482 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Structure
PDB: 

Jmol
Position
581787..582398
Genome map
AA seq 203 aa AA seqDB search
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLY
GFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGA
ERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEL
GKDGAVATSSALRAALSLLGKTR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattttctcggtacgcggcgaggtactcgaggtggcacttgaccacgccgtcatcgaa
gccgccggtatcggctatcgggtaaacgcgacgccgtcggcgttggcgacgttgcggcag
ggcagccaggcccgactggtcaccgcaatggtcgtgcgcgaggactcgatgacgttgtac
gggttttctgatgccgagaaccgtgacctattcctagcgctgctgtcagtctcgggagtt
gggcctcgccttgccatggcgacattggccgtgcacgacgctgcggcgcttcggcaggca
ctggccgatagtgatgtcgcctcgctgacccgggtgcccggtatcggcaagcgtggtgcc
gaacggatagtgctggagttacgcgacaaggttggcccggtaggggcgtctggattgact
gtgggtactgctgctgacggcaacgcggtgcgaggttctgtggtcgaagccctggtaggg
ctgggttttgcggccaagcaggccgaggaagcgaccgaccaggtgctcgacggtgaactt
ggaaaagatggggcggtggcaacgtccagcgccttgcgggctgctctgtcgttgctgggc
aagacccgatga

DBGET integrated database retrieval system