KEGG   Mycobacterium leprae TN: ML0532Help
Entry
ML0532            CDS       T00047                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mle  Mycobacterium leprae TN
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mle00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mle00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
645581..646546
Genome map
AA seq 321 aa AA seqDB search
MMRRHLLNAGDLSRDDAIAIFDDADRFAHALVGREIKKLPTLRGRTVITMFYENSTRTRV
SFEVAGKWMSANVINVSPAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLADW
TAAETGEDGPAVINAGDGTHEHPTQALLDALTIRQRLGSIEGRRILIVGDILHSRVARSN
VVLLDTLGAEVVLVAPRTLLPIGVDGWPATVSCDFDAELPAADAVLMLRVQAERMNGGFF
PSVREYSCLYGLTERRQALLPGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHV
RMAVLFHVLVGTQSAEEEGAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgcagacatctgctgaacgccggtgatttgagccgcgacgatgccatcgccatc
ttcgacgatgccgaccggttcgcgcatgctctggtgggtcgcgagatcaagaagctgccg
acgctacgaggtcgcacggtaatcacgatgttctacgaaaattcgactcgcacccgcgtg
tcgttcgaggtggccggcaagtggatgagcgccaatgtgatcaacgtcagcccggctgga
tcgtcggtgggtaagggcgaatcgttgcgtgacaccgcgctgacactgcgtgcggccggt
gctgacgcgttgattatccggcacccggcttccggtgctgcccatctgcttgccgattgg
actgctgctgagaccggcgaggatggtccggcggtgatcaacgccggcgacggcactcat
gagcacccgacccaggcgctgctggacgcgctcaccatccgtcagcggctcggtagcatt
gaaggccggcgcatcttgatcgtcggcgacatcttgcacagccgggttgcgcggtccaac
gtcgtgctgctagacaccctgggtgctgaggtggtgctggtggcgccgcggactttgttg
ccgattggggttgacggctggccagccaccgtctcatgcgactttgacgctgaactgcct
gccgccgatgcggtgctgatgctgcgagtacaggccgaacggatgaatggcgggtttttc
ccgtcggtacgcgagtattcttgtctctacgggctaaccgagcggcgccaggcactgttg
cccggccatgcagtggtgctgcacccagggccgatgctacgtggcatggagatcgcctct
tctgttgctgactcgtcgcaatcagctgttttgcaacaggtttccaacggtgtgcatgtg
cggatggcagtgcttttccatgttctggttgggacccagtcggccgaagaagagggtgcg
gcatga

DBGET integrated database retrieval system