KEGG   Mycobacterium leprae TN: ML0572Help
Entry
ML0572            CDS       T00047                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mle  Mycobacterium leprae TN
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML0572 (tpiA)
   01230 Biosynthesis of amino acids
    ML0572 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML0572 (tpiA)
   00051 Fructose and mannose metabolism
    ML0572 (tpiA)
   00562 Inositol phosphate metabolism
    ML0572 (tpiA)
Enzymes [BR:mle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ML0572 (tpiA)
Exosome [BR:mle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ML0572 (tpiA)
  Exosomal proteins of bladder cancer cells
   ML0572 (tpiA)
  Exosomal proteins of melanoma cells
   ML0572 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
697158..697943
Genome map
AA seq 261 aa AA seqDB search
MSRKSLIAGNWKMNLNHFEAIALVQKIAFSLPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTYGAQDLSQHDLGAYTGDISGAFLAKLGCSFVLVGHSERRTYHDEGDALVAAKTAA
ALKNSLTPIVCIGEYLEIREVGEHVSHCQNQLRGSLAGLSPEQIGNVVIVYEPVWAIGTG
RVASAADAQEVCEAIRKELGALASPQVAETVRVLYGGSLNAKNIGDIVAQQDVDGGLVGG
ASLDGAQFATLAVIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagtcgctcatcgccggcaactggaagatgaacctgaatcatttcgaggcg
attgcgttggtgcaaaaaatcgctttttcattgccggacaagtattatgacaaggttgat
gtcacagttcttccgccattcactgacctgcgtagcgtgcaaaccctggtcgatggcgat
aagttgcgattgacctatggtgcccaggatctttcgcaacatgacctaggcgcctacact
ggagacatcagtggggccttcttggctaagttgggctgtagcttcgtgctggtggggcac
tctgagcggcgcacctaccacgacgaaggtgacgcgctggtggccgcgaagacggctgcg
gcgctcaaaaacagcttgactccgatcgtgtgcatcggcgagtacctcgagatccgagag
gtgggtgaacacgtcagccactgccagaaccagctacgcggctcgctggctgggctgtcg
cctgaacagatcggcaatgtcgtgatcgtttatgaaccggtctgggcgatcgggactggg
cgggtggctagtgcagccgacgcccaagaggtgtgcgaggcgatccgaaaagagctgggt
gcgctggcatcaccgcaggtggccgaaaccgttcgggtgctttatggtggctcgttgaac
gccaaaaacattggcgatatcgtcgcccagcaagacgtcgatggtggtctggttggggga
gcgtcgctggacggggcgcaattcgcgacgctcgcggtcatcgccgccggtgggcctctt
ccctag

DBGET integrated database retrieval system