KEGG   Mycobacterium leprae TN: ML0698Help
Entry
ML0698            CDS       T00047                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protei
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mle  Mycobacterium leprae TN
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML0698 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML0698 (sdhD)
   00650 Butanoate metabolism
    ML0698 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ML0698 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(836441..836932)
Genome map
AA seq 163 aa AA seqDB search
MSNSDLQLRPQVQPTCQKGQLAPVRQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRF
SGVALVVLAFGHLFIMLMWDNGVYRIDFNFVAQRWSSPFWRFWDLALLWLAQVHGGNGLR
NIIDDYSRKDHTRFWLNSLLLLSMGFTLVLGSYVLLSFDPNIS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactccgatcttcagctcagacctcaagttcaacctacatgccaaaaaggccag
ttagccccggtgcggcagcgcagctacgaccgccccgcaagcttagacaaccctcgttca
ccgcgtcgacgcgccggcatccccaacttcgaaaagttcgcctggctgttcatgcggttc
tcgggtgtcgcgctggtggtactggcgttcgggcacttattcatcatgctgatgtgggac
aacggcgtgtaccgcatcgacttcaactttgtggcgcagcgctggtcttcaccgttctgg
cgattctgggacctggcactactgtggctggcgcaagtccacggcggcaacggcttgcgc
aacatcatcgacgactacagccgcaaagaccacacgcggttctggctcaatagcttgctg
ctgttgtcaatggggttcacgctggtgctgggcagctacgtgctgttgtcattcgatccc
aacatctcctga

DBGET integrated database retrieval system