KEGG   Mycobacterium leprae TN: ML0698Help
Entry
ML0698            CDS       T00047                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mle  Mycobacterium leprae TN
Pathway
mle00020  Citrate cycle (TCA cycle)
mle00190  Oxidative phosphorylation
mle00650  Butanoate metabolism
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01120  Microbial metabolism in diverse environments
mle01130  Biosynthesis of antibiotics
mle01200  Carbon metabolism
Module
mle_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML0698 (sdhD)
   00650 Butanoate metabolism
    ML0698 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ML0698 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF5345
Motif
Other DBs
NCBI-GeneID: 909593
NCBI-ProteinID: NP_301557
Pasteur: ML0698
UniProt: Q7AQF8
Position
complement(836441..836932)
Genome map
AA seq 163 aa AA seqDB search
MSNSDLQLRPQVQPTCQKGQLAPVRQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRF
SGVALVVLAFGHLFIMLMWDNGVYRIDFNFVAQRWSSPFWRFWDLALLWLAQVHGGNGLR
NIIDDYSRKDHTRFWLNSLLLLSMGFTLVLGSYVLLSFDPNIS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactccgatcttcagctcagacctcaagttcaacctacatgccaaaaaggccag
ttagccccggtgcggcagcgcagctacgaccgccccgcaagcttagacaaccctcgttca
ccgcgtcgacgcgccggcatccccaacttcgaaaagttcgcctggctgttcatgcggttc
tcgggtgtcgcgctggtggtactggcgttcgggcacttattcatcatgctgatgtgggac
aacggcgtgtaccgcatcgacttcaactttgtggcgcagcgctggtcttcaccgttctgg
cgattctgggacctggcactactgtggctggcgcaagtccacggcggcaacggcttgcgc
aacatcatcgacgactacagccgcaaagaccacacgcggttctggctcaatagcttgctg
ctgttgtcaatggggttcacgctggtgctgggcagctacgtgctgttgtcattcgatccc
aacatctcctga

DBGET integrated database retrieval system