KEGG   Mycobacterium leprae TN: ML0706Help
Entry
ML0706            CDS       T00047                                 

Gene name
pmmB
Definition
phospho-sugar mutase
Orthology
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
mle  Mycobacterium leprae TN
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mle00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mle00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(843847..845463)
Genome map
AA seq 538 aa AA seqDB search
MKAAVTPEEWITHDPDPQTAAELAACDPDELAARFTRALRFGTSGLRGPVRGGPDAMNLA
VVLRATWAVAQVLLQRAGSRPATVIVGRDSRHGSAAFVAATAEVLAAEGFSVLLLPNPAP
TPVVAFAVRNTGAAAGIQITASHNPPTDNGYKVYFDGGIQIISPIDHQIENAMAAAPLAD
QITRKPVNPSENSASDLVDHYIQRAAAVRRSNGSVRVALTPMHGVGGAVAVETLRRTGFD
DVHTVAAQFEPDPDFPTVAFPNPEEPGATDALLALAAHVGADVAIALDPDADRCAVGIPT
NSGWRMLSGDETGWLLGDYILSQTDKPETAVVASTVVSSRMLPAIATHYNAVHVETLTGF
KWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAAVLVCDLVAALHKQGRSVPDM
LDQLALRHGVHDVTAISRRIGPKQTGVDEAVDLIQRLRAAPPSQLAGFTATTTDITDALI
FTGGDDDTWVRVVVRLSGTEPKLKCYLEVRCSVAGNLPSTRQRARVLRDELVTLVQQW
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggctgccgtgacacccgaagagtggatcacgcacgatcccgacccacagacagcc
gccgagctggccgcgtgcgaccccgatgaacttgcggcgcggttcacccgtgcactgcgc
ttcggcacgtcgggcttgcgcggaccagtgcgcggcggccccgacgccatgaacctagcg
gtggtgttgcgagcgacctgggccgtggcacaggtgctcctgcaacgagcgggctcgcgg
cctgcaaccgtaatcgtcgggcgcgactctcggcacggctcggcggcattcgtcgctgcg
accgctgaggtgcttgccgctgaaggtttttccgttctgctgctacccaatccggcaccc
acgccggtggtggcgtttgcggtgcgcaataccggcgccgcggccgggatccagatcaca
gcatcgcacaacccgccgaccgataacgggtacaaggtgtatttcgacggcggcatccag
atcatctctcccattgaccaccaaatcgaaaacgcgatggccgctgctcccctggccgac
cagatcaccaggaaacccgtaaaccccagtgaaaacagcgcctccgatctggttgaccat
tatattcagcgagcggccgcggtacggcgctccaacggttcagttcgggttgcccttaca
ccgatgcacggagtgggcggtgcggtagccgtcgagacgctgcggcgcaccggctttgac
gacgtgcacaccgtagcggcgcagttcgagcccgaccccgactttccaaccgtcgcgttc
ccaaacccggaggagcccggcgccaccgacgcattgctggccctggccgcccatgtcggg
gccgacgtcgcgatagcactggaccccgacgccgaccgctgcgccgttggtatacccacc
aactcgggatggcggatgctgtccggagacgaaaccggttggctgctaggcgattacatt
ttgtcgcaaaccgacaagccggaaaccgccgtggtagccagtaccgtggtgtcgtcgcgt
atgttgccagcaatcgccacacactacaacgcggtccacgtcgagaccctcaccggcttc
aagtggctggcgcgcgccgacgcaaacctgccgggcactcttgtgtacgcctatgaggaa
gctatcgggcattgtgtcgaccccactgccgtacgcgacaaagacggcatcagcgccgcg
gtgttagtgtgcgatctggttgccgcactgcacaagcagggccgctcggtgcccgacatg
cttgaccaactcgccctacgccacggcgtgcacgacgttacagcaatatcacgtcgcatt
ggccccaaacaaacgggagttgacgaggctgtcgacctgattcagcggctacgcgcagcc
ccgccgagtcagctggccgggttcaccgcgaccactaccgatatcaccgacgcgctaatc
ttcaccggcggtgatgatgacacgtgggtccgggtagtggtgcggctatcaggaaccgaa
ccgaagttaaagtgctacttggaagttcgctgctcggtggctggcaacctaccatccacc
cgacaacgggccagggtgctgcgcgacgagctagtcaccttggtgcagcagtggtga

DBGET integrated database retrieval system