KEGG   Mycobacterium leprae TN: ML0861Help
Entry
ML0861            CDS       T00047                                 

Gene name
dlaT
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mle  Mycobacterium leprae TN
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML0861 (dlaT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML0861 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    ML0861 (dlaT)
Enzymes [BR:mle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ML0861 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1023121..1024713)
Genome map
AA seq 530 aa AA seqDB search
MACSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGAPSEAAAAAPAPRPEPKAQPEPAASSQPAAPAQQPSGAATATP
VLMPELGESVTEGTVTRWLKKIGDSVQADEPLVEVSTDKVDTEIPSPVAGVLVSITTNED
TTVPVGGELARIGVTLDSIATPAPAPRAESVPSRPTPARKEANGAPYVTPLVRKLATENN
IDLAKVIGTGVGGRIRKQDVLAAAEQRKQQQAPTSAPSAAAPTPTPVLAHLRGTTQKVSR
IRQITAKKTRESLQATAQLTQTHEVDMAKIVGLRAKAKAAFAEREGVNLTFLPFIAKAAI
DALKIHPNINASYNEDTKEITYYDAEHLGFAIDTDKGLLSPVIHYAGDLSLAGLARAIVD
IAARARSGNLKPEELSGGTFTITNIGSQGALFDTPILVPPQAAMLGIGAIVKRPRVVIDA
SGNESIGVRAICYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctccgtccagatgccggcactcggtgaaagcgtcaccgaggggacagttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagccactcgtcgaggtgtcg
accgataaggtcgacaccgaaatcccctcgcctgccgcgggtgtgctgaccaaaatcatc
gcccaggaggacgacaccgttgaagtgggcggtgaacttgccgttatcggcgcgccttcc
gaagcggctgcagcggcgcctgcgccccggccagaacctaaggcccaacccgaacccgca
gcatcatcccaacctgccgcaccggcccagcaaccttccggcgcagcaaccgcgacaccg
gttctgatgcccgagctcggcgagtctgtaaccgaaggcacggtgactcgctggcttaag
aagatcggagactcggttcaggctgacgagccactggtagaggtatcgaccgacaaggta
gataccgagatcccgtcaccggtggccggcgttttggtcagcatcaccaccaacgaagac
acaaccgtcccggttggcggtgagttggcacggataggtgttactctcgacagcatcgcc
acccccgcgccagcgcccagagccgaatccgtaccgtcccggccgacgccagccaggaaa
gaagccaatggcgcaccgtacgtgaccccgctggtacgaaaactcgccaccgaaaacaac
atcgacctggccaaagtgataggcaccggtgtgggcggtcgcatccgtaagcaggacgtg
ctggccgcggccgaacaacggaaacagcagcaggcaccgacatccgcgccatcagcagcc
gctcccaccccgacacccgtgctggcccacttgcgaggcaccacccaaaaggtcagccgg
attcggcaaatcaccgcgaaaaagacccgcgaatccctgcaggccacggcgcaactcacc
cagacccatgaggtcgatatggccaagattgtggggttgcgagccaaagccaaggcagct
ttcgccgagcgcgaaggggtgaacctgactttcctgccgtttatcgccaaggcagcgatc
gacgccctcaaaattcatcccaatattaacgccagctacaacgaggacactaaggagatc
acctattacgacgccgagcacctcggcttcgcaatcgacactgacaagggcctgctctcc
cctgttatccactatgccggtgatttgtcgctggccgggctggcccgcgcaattgttgat
atcgccgcccgggctcggtcaggcaatttgaaacccgaggagctgtccggtggcacattc
accattaccaacatcggcagccagggcgcgttgttcgacacaccgatcctggttccgccg
caggcagcaatgctgggcatcggagccatcgtaaaacgcccgcgggtggtcatcgatgct
agcggtaatgagtcgattggggtccgcgcgatttgctatctgccgctgacctatgaccac
cgactgatcgacggcgccgatgccggacgtttcctcactaccatcaagcaccggctcgaa
gagggagcattcgaggccgacctaggtctttag

DBGET integrated database retrieval system