KEGG   Mycobacterium leprae TN: ML0984Help
Entry
ML0984            CDS       T00047                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mle  Mycobacterium leprae TN
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ML0984
Enzymes [BR:mle01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     ML0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1151024..1151518)
Genome map
AA seq 164 aa AA seqDB search
MYHAIAPLCHVSPKLVAIAELTEASVQGVENIRTVEVFLAALQDAGLRNRIRDVGRQPRV
YQNVGLPTIHGRSKTITLWRKMADCIGFEIKIHRIAAVAIAVLCERADAVIVGPLWMQFW
VCGTFEVQNKRIMLWRNYFDLFDLFKATMRSLVALRIPSLNAAF
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccatgccatagcaccgttatgtcatgtttcccctaagctggtagccatagctgag
ctgaccgaggcatctgtccaaggtgttgaaaacattcgcacggtcgaggttttcttggct
gccctgcaggacgcaggattacgaaaccgcatacgcgacgttggacgacaacctcgtgtt
taccagaacgtcggactgccaacaatccatggccgtagcaaaacgatcacactgtggcgt
aagatggcagactgtatcgggtttgagataaagatccaccgaattgccgccgtggctata
gccgtgctctgcgaacgcgccgacgcggtgatcgtcggcccactttggatgcaattctgg
gtctgtggcaccttcgaagtgcaaaataagcgaatcatgttgtggcggaattattttgat
ttgttcgatctgttcaaggcaaccatgcgaagcctggtcgcgctgagaatcccgtcgtta
aacgcagcgttctaa

DBGET integrated database retrieval system