KEGG   Mycobacterium leprae TN: ML1044Help
Entry
ML1044            CDS       T00047                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mle  Mycobacterium leprae TN
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mle00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1209287..1210642
Genome map
AA seq 451 aa AA seqDB search
MTSRSYCVVGGGISGLTAAYRLRVATGDDVAITLFDPGDRLGGVLRTECVGGQPMDLGAE
AFLLRRPEVPALLAELGLSERQRATTDARPLIYSQQRLHSLPPDTVAGIPSSATSVAGLV
DDATVARIGAEAVRPLSWEPGSDPAMAELVADRFGEQAVARLVDPLLGGVYAGSAATIGL
RAGAPSVAAALDCGATSLMEAVRQGLPPVAAGPVFGALDGGYQVLIDELVRRSRLQWVAA
TVVGLDRGTCGWTLVDDTGACWSADGVILAVPAPRLVRLLQQIAPRTVAAASRIVSASSA
VVALSVPRDTTFPQNSGVLVASGERLRAKAVTLSSRKWGLQGDTQLVRLSFGKFGDQVAS
TASDDELLAWAVSDLAAVFDVTVDPVDVCVQRWIDAMPQYGPGHADLVAEVRAGLPPTLV
VAGSHMDGIGVPACISAAGRAIEALQAEVAR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgctcgtattgtgttgtgggtggcggaatctcgggacttacggcggcatat
cggttaagggtggctacgggtgacgatgttgctatcactttgttcgatcctggtgaccga
ctcggcggggtgttgcgcaccgagtgcgtaggcggacagccgatggacttgggcgccgag
gcattcttgctgcgccgtcccgaggtgccggcgttgctggccgagttgggtttgtcagag
cgccaacgcgccaccaccgatgcccgaccattgatctacagccagcaacggctgcattcg
ttgccaccggacaccgtcgccggcattccgtcctcggcgacgtcggtggccggcttggtc
gacgacgccacagttgcgcgtatcggcgccgaagctgtccgtccgctgagctgggaaccc
ggcagcgatcccgcgatggccgaattagtggccgaccggttcggcgagcaggccgtggcc
cggttggtggacccgctgttgggcggcgtctatgctggctcggcagcgacgatcgggctg
cgcgcgggcgccccgagtgtggcggctgccctcgactgcggggccaccagtttgatggag
gcggttcgacaggggttgccgccggtagcggccgggccggtttttggagcgctagacggc
ggctaccaggtgctgatcgacgagctcgtccgccgcagccgactgcagtgggtagctgcc
accgtggtagggctcgatcgtgggacttgcggttggacgctagtggacgacaccggtgct
tgctggtccgccgacggggttatcctggccgttcccgccccacggctcgtgcgcctgttg
cagcagatcgccccccgaacagtcgccgccgcaagccggatcgtgagtgcctcgtcggcg
gtggtggcactgtcggtgccccgggacaccacattcccgcagaattccggtgtgttggtg
gctagcggcgagcggctgcgagctaaagcggtcacgttgtcctcacgaaagtgggggctt
caaggggacacacagttggtgcggctttcgttcgggaagtttggtgatcaggtggcctcg
actgcctcggacgatgagctgctggcttgggcggtgtccgacctggccgcggtattcgat
gtgaccgtcgaccccgtcgatgtatgcgtgcagcggtggatcgacgcaatgccgcagtat
ggccccggtcacgccgatctggtcgccgaggtgcgcgccggcttgccgccgacgctggtc
gtggctggcagccatatggacggtattggtgtgcctgcgtgtatcagcgctgccgggcgc
gcgatcgaggccctccaagcggaagtggcacgataa

DBGET integrated database retrieval system