KEGG   Mycobacterium leprae TN: ML1044Help
Entry
ML1044            CDS       T00047                                 

Gene name
hemY
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00860  Porphyrin and chlorophyll metabolism
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ML1044 (hemY)
Enzymes [BR:mle01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ML1044 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     ML1044 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 Rossmann-like
Motif
Other DBs
NCBI-GeneID: 910131
NCBI-ProteinID: NP_301770
Pasteur: ML1044
UniProt: Q50008
Position
1209287..1210642
Genome map
AA seq 451 aa AA seqDB search
MTSRSYCVVGGGISGLTAAYRLRVATGDDVAITLFDPGDRLGGVLRTECVGGQPMDLGAE
AFLLRRPEVPALLAELGLSERQRATTDARPLIYSQQRLHSLPPDTVAGIPSSATSVAGLV
DDATVARIGAEAVRPLSWEPGSDPAMAELVADRFGEQAVARLVDPLLGGVYAGSAATIGL
RAGAPSVAAALDCGATSLMEAVRQGLPPVAAGPVFGALDGGYQVLIDELVRRSRLQWVAA
TVVGLDRGTCGWTLVDDTGACWSADGVILAVPAPRLVRLLQQIAPRTVAAASRIVSASSA
VVALSVPRDTTFPQNSGVLVASGERLRAKAVTLSSRKWGLQGDTQLVRLSFGKFGDQVAS
TASDDELLAWAVSDLAAVFDVTVDPVDVCVQRWIDAMPQYGPGHADLVAEVRAGLPPTLV
VAGSHMDGIGVPACISAAGRAIEALQAEVAR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgctcgtattgtgttgtgggtggcggaatctcgggacttacggcggcatat
cggttaagggtggctacgggtgacgatgttgctatcactttgttcgatcctggtgaccga
ctcggcggggtgttgcgcaccgagtgcgtaggcggacagccgatggacttgggcgccgag
gcattcttgctgcgccgtcccgaggtgccggcgttgctggccgagttgggtttgtcagag
cgccaacgcgccaccaccgatgcccgaccattgatctacagccagcaacggctgcattcg
ttgccaccggacaccgtcgccggcattccgtcctcggcgacgtcggtggccggcttggtc
gacgacgccacagttgcgcgtatcggcgccgaagctgtccgtccgctgagctgggaaccc
ggcagcgatcccgcgatggccgaattagtggccgaccggttcggcgagcaggccgtggcc
cggttggtggacccgctgttgggcggcgtctatgctggctcggcagcgacgatcgggctg
cgcgcgggcgccccgagtgtggcggctgccctcgactgcggggccaccagtttgatggag
gcggttcgacaggggttgccgccggtagcggccgggccggtttttggagcgctagacggc
ggctaccaggtgctgatcgacgagctcgtccgccgcagccgactgcagtgggtagctgcc
accgtggtagggctcgatcgtgggacttgcggttggacgctagtggacgacaccggtgct
tgctggtccgccgacggggttatcctggccgttcccgccccacggctcgtgcgcctgttg
cagcagatcgccccccgaacagtcgccgccgcaagccggatcgtgagtgcctcgtcggcg
gtggtggcactgtcggtgccccgggacaccacattcccgcagaattccggtgtgttggtg
gctagcggcgagcggctgcgagctaaagcggtcacgttgtcctcacgaaagtgggggctt
caaggggacacacagttggtgcggctttcgttcgggaagtttggtgatcaggtggcctcg
actgcctcggacgatgagctgctggcttgggcggtgtccgacctggccgcggtattcgat
gtgaccgtcgaccccgtcgatgtatgcgtgcagcggtggatcgacgcaatgccgcagtat
ggccccggtcacgccgatctggtcgccgaggtgcgcgccggcttgccgccgacgctggtc
gtggctggcagccatatggacggtattggtgtgcctgcgtgtatcagcgctgccgggcgc
gcgatcgaggccctccaagcggaagtggcacgataa

DBGET integrated database retrieval system