KEGG   Mycobacterium leprae TN: ML1063Help
Entry
ML1063            CDS       T00047                                 

Gene name
folP2
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mle  Mycobacterium leprae TN
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mle00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1228776..1229651
Genome map
AA seq 291 aa AA seqDB search
MQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAEGADVIDVGGV
KAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRAEVARLACTAGADLINDSWGG
ADPAMHEVAAELGAGLVCSHTGGALPRTRPFRVSYGTTTRGVVDDVIRQVTAAAERAVAA
GVTRDSVLVDPTHDFGKNTFHGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTER
LEGTLAATALAAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtcaatgctgtgcggccggccggtcgcagcggatcgccaactgatcatggcgatc
gtcaaccgtaccccggattcgttctatgaccggggcgcgaccttcagtgacgaggctgct
cgtgctgcagcgcaccgggccgttgcggagggcgccgatgtcatcgatgtcggcggcgtt
aaagcagggcctggtcagggcgttgacgtagacaccgagatcgcccggttggttccgttc
atcgaatggctacgcagcgcctatacagacctgctgatcagcgtagacacctggcgagca
gaggtagcaagactggcttgcactgcgggcgcagacctgatcaacgacagctggggtgga
gccgacccggccatgcatgaggtcgccgctgagcttggcgcgggcctggtgtgttcgcac
accggtggcgcgctgccccgcacgcgtccctttcgggtgagttacggtacgacgacccgc
ggtgtggtggacgatgtgattcgccaggtcactgcagctgccgagcgcgcggtcgcggcc
ggggtaacccgcgattcggtgttggtcgacccgacccacgatttcggcaagaacactttc
cacgggctgctgctgttgcgtcatgtagacgaacttgttaagaccgggtggcccgtgctc
atgtcgttgagcaataaggacttcgtcggggagactctgggcgtgggtttgacggaacgg
ctagagggtacgttggcggccactgcgttggcggcggcagctggcgtccgcatgtttcgg
gtgcacgaggtcgtagcgaccaggcgggttctggagatggtggcttcgatccaggggacg
cgtcccccaacgcgcacggtgaggggactcgcatga

DBGET integrated database retrieval system