KEGG   Mycobacterium leprae TN: ML1130Help
Entry
ML1130            CDS       T00047                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00260  Glycine, serine and threonine metabolism
mle00750  Vitamin B6 metabolism
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01120  Microbial metabolism in diverse environments
mle01230  Biosynthesis of amino acids
Module
mle_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML1130 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ML1130 (thrC)
Enzymes [BR:mle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ML1130 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 910224
NCBI-ProteinID: NP_301824
Pasteur: ML1130
UniProt: P45837
Position
1320964..1322046
Genome map
AA seq 360 aa AA seqDB search
MSGQQTTTHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAAPRLSEQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPMISLVNSVNPVRIEGQKTAVFEI
VDALGTAPHVHALPVGNAGNITAYWKGYTEYHADGLIDRLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAATDEEILAAYHLVARAEGVFVEPASA
ASIAGLLKAIDGGWVARGSTVVCTITGNGLKDPDTALKDMPSVSPVPVDAVAVVEQLGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggccagcagacgaccacccaccagccttggccgggtgtgatcgcagcgtaccga
gaccgactaccagtgggcgacgattggaccccggttaccttgctagaaggtggcacgccg
ctcattgctgcgcccagactctccgaacagactggctgcacgattcacctcaaggtagag
ggcctcaaccccaccggctccttcaaagacaggggcatgacgatggcggtgaccgatgca
ctggcccgcgggcaacgtgccgtgttatgcgcgtcgacgggaaacacctcggcgtcggcg
gcggcatacgctgcccgcgccggtattacctgtgcggtgctaattccgcagggtaaaatt
gcgatgggcaagctcgcacaggcggtcatgcatggagccaagatcattcagatcgacggc
aacttcgacgattgcctggaactggctcgtaaaatggctgctgatttcccgatgatctcg
ttggtcaactcggttaacccggtgcgaatcgaaggtcaaaagacagcggtgttcgagatc
gttgacgcgctaggcaccgcaccacacgtgcatgcccttccggtcggcaacgctgggaac
atcactgcgtactggaaaggatacaccgaatatcacgctgatggtctgatcgacagactg
cctaggatgttgggtactcaggccgcgggcgcggctcccctggtactcggcgagcctgtg
agccatcccgaaaccatcgctactgcgatccgcattggctcgccggcgtcatggacgtcg
gctgtcgaagcccagcagcaatccaagggacgattcctggccgcgacggatgaggagatt
ctggctgcataccatctggtggcacgtgctgaaggcgtcttcgtcgaacccgcatcggcg
gccagcatcgccggcctcctcaaggccatcgatggtggctgggtggctcgtgggtcaacg
gtggtgtgtacgataaccggcaacggtctgaaggatcccgacacggcgttgaaggatatg
ccgagcgtctccccagtgcctgtcgatgcggtcgctgttgtcgagcagttagggctggtc
tag

DBGET integrated database retrieval system