KEGG   Mycobacterium leprae TN: ML1150Help
Entry
ML1150            CDS       T00047                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mle  Mycobacterium leprae TN
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mle00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mle00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1339580..1340836
Genome map
AA seq 418 aa AA seqDB search
MAERFVVTGGNRLSGEVTVGGAKNSVLKLMAATLLAEGTSTITNCPDILDVPLMAEVLRG
LGATVELYGDVARITSPDEPKYDADFAAVRQFRASVCVLGPLVGRCKQARVALPGGDAIG
SRPLDMHQAGLRQLGARCNIEHGCVVASAETLRGAEIQLEFPSVGATENILMAAVVAEGV
TTIHNAAREPDVVDLCTMLNQMGAQVEGVGSPTMTITGVPRLYPTEHRVIGDRIVAATWG
IAAAMTRGDIAVTGVDPAHLQLVLHKLHDAGATVTQTDDSFRVAQYERPKAVNVATLPFP
GFPTDLQPMAIALTSIADGTSMITENVFEARFRFVEEMIRLGADARTDGHHAVVRGLPQL
SSAPVWCSDIRAGAGLVLAGLVADGDTEVYDVFHIDRGYPLFVENLANLGAEIERVCL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagcgattcgtggtgaccggcggcaaccggttgtcaggcgaagtcaccgtcgga
ggtgccaagaacagcgtcctcaagcttatggccgcgactttgttggccgaaggcaccagc
acgatcaccaattgccccgacatcctcgatgtgccactgatggcggaggtgctgcggggt
ctaggcgccactgtcgaactctatggtgacgttgccagaatcacttcgcctgatgaaccg
aagtacgatgctgacttcgctgccgtgcggcagttccgggcttcggtctgtgtgctgggg
ccgctggtcggccggtgcaaacaagccagggtcgcgcttccgggcggtgacgctatcgga
tcgcgtccgctagatatgcatcaggctggtctacggcagctgggagcacgctgcaatatc
gagcacggatgcgtggtggcttccgcagaaacattgcgcggcgctgagattcagttggag
tttccttcagtgggcgctaccgagaacatcctgatggcagctgttgtggctgagggtgtg
accacaattcacaatgcagcccgggaacccgacgtggttgacctgtgcacgatgttgaac
cagatgggtgcacaggtcgaaggcgtgggttcgccgaccatgacgatcaccggcgtcccg
cggctctacccgaccgaacaccgcgtcatcggagaccggattgtagccgctacgtggggc
attgctgctgccatgacccgcggcgacatagctgtgactggcgttgatcctgctcacctt
cagctagtgttgcataagttgcatgacgcgggtgctaccgtaacccagacggacgacagc
tttcgcgtggcccagtacgagcgcccgaaggccgtcaatgtggcgaccttgccatttccc
ggttttccgaccgatttgcagccaatggcgatcgctttgacttcgatcgctgatggcacg
tcgatgattacggagaatgtgtttgaggcacgattccgctttgtcgaagagatgatccgg
ctgggtgccgatgcccgcacggatgggcaccatgccgttgtgcggggtcttccacaactc
tcgagcgcgccggtctggtgttcggatatccgtgctggtgccggtttggtactcgcggga
cttgtcgctgatggagacaccgaggtctacgacgttttccacatcgatcgcgggtatcca
ttgttcgtggagaacctggcgaatttaggagccgagatcgagcgagtatgcttgtag

DBGET integrated database retrieval system