KEGG   Mycobacterium leprae TN: ML1257Help
Entry
ML1257            CDS       T00047                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mle  Mycobacterium leprae TN
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mle01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mle00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1502297..1503646
Genome map
AA seq 449 aa AA seqDB search
MSITPPFLLACIDLRGAELTATQLRATLPRGGADVEAVLPTVWPIVQAVAECGADAALEF
GALFDGVRPPTVRVPDAALDAALAGLDPDVRDALQVMIERTRVVHADQRRTDVTTALGPG
ATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVDSLVVASPPQFTSGGRFHGL
PHPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDSDDCELAPVDMITGPGNIYVTAAKR
LCRSRVGIDGEAGPTEIAILADHTADPAHVAADMISQAEHDEMAASVLVTPSTDLADATD
AELAAQLRTTVHRKRVVAALGGRQSAIILVDDLEAGVKVVNLYAAEHLEIQTAEASRVAS
RIRCAGAIFVGPWAPVSLGDYCAGSNHVLPTAGFARHSGGLSVQTFLRGIHVVNYTKTAL
KDISGHVITLAKAEDLPAHGEAVRRRFAR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcacgccaccattcctgctagcctgcattgatctgcggggagctgagttgacg
gctacccagttgcgggccacgctgccgcgcggtggcgccgacgtggaggctgtgctgcct
acggtgtggccgatcgtgcaggccgtcgccgagtgcggggccgatgcggctttggaattc
ggggcgttattcgacggcgtgcggcccccgactgtccgggtgcccgacgccgcgctggac
gccgcgctggcaggattggaccccgatgtccgcgacgcgttgcaggtgatgatcgagcgg
acccgcgttgtgcatgccgaccagcgccgcaccgacgtcactaccgcgctcggcccgggt
gcgacggtcaccgaacggtgggttcccgttgagcgggtgggcctttatgtacccggcggc
aatgcggtgtacccgtccagcgtggtgatgaacgtggtgccggcacagaccgcgggtgtc
gattccctggtggtggccagccctccgcagttcacttccggtggccggtttcacggactg
ccgcatccgacgattctggccgcggcacggctactgggagttgacgaagtctgggccgtc
ggcggggcacaggcagtggcgttgcttgcttacggaggcaccgatagtgacgattgcgag
ctggcaccggtcgacatgatcaccgggccaggcaatatctacgtcactgccgccaagcgg
ttatgtcgctctcgggtgggtatcgacggcgaggccggtccgaccgagattgccatcctc
gccgaccataccgcagatccagcacatgtggctgccgacatgatcagccaggccgaacat
gacgaaatggctgccagtgtattggtgaccccaagtacggatctggctgatgccaccgac
gccgaattggctgcccagctgcggaccacggtgcatcggaaacgggtggtggcagcacta
ggaggacgccagtcagctatcattttggtcgacgatctggaggctggtgtcaaagttgtc
aatctctacgcagctgaacatctggagatccagactgctgaagcttcacgagtcgcgagc
agaatacgttgtgcaggagctattttcgttggcccgtgggcaccggtcagcctcggtgac
tactgcgctgggtccaaccacgtattgccgaccgcgggctttgcccggcattccggcggc
ctgtcagtgcagaccttcctgcgtggcatccatgttgtcaactacaccaagacggctctc
aaagacatatccggacacgttatcacgttggccaaagccgaagacctgccggcgcatggg
gaggcggtacggcggagattcgcgcgatga

DBGET integrated database retrieval system