KEGG   Mycobacterium leprae TN: ML1271Help
Entry
ML1271            CDS       T00047                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01130  Biosynthesis of antibiotics
mle01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ML1271 (trpC)
Enzymes [BR:mle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ML1271 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh
Motif
Other DBs
NCBI-GeneID: 910382
NCBI-ProteinID: NP_301916
Pasteur: ML1271
UniProt: Q9X7C7
Position
1514500..1515318
Genome map
AA seq 272 aa AA seqDB search
MCPATVLDSILKGVRADVAAREACISLSEIKAAAAAAPAPLDAMAALREPGIGVIAEVKR
ASPSVGSLATIADPAKLAQAYEDGGARIISVLTEERRFNGSLDDLDAVRAAVSVPVLRKD
FVVQPYQIHEARAHGADMLLLIVAALDQSALMSMLDRTESLGMIALVEVRTEQEADRALK
AGAKVIGVNARDLMTLEVDRDCFSRIAPGLPSNVIRIAESGVRGPADLLAYAGAGADAVL
VGEGLVKSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccggcaactgtgcttgactccattctaaagggagtccgggccgacgttgccgca
cgcgaagcctgcatcagcctgtccgaaatcaaagccgccgccgcggccgcaccagcaccg
ctggacgctatggccgctttacgtgagcccggtattggtgttatcgccgaggtcaagcgc
gccagtccatcggtgggctcattggccaccatcgctgatccggcaaagctggcccaggcc
tacgaggacggcggtgctcggatcatcagcgttttgaccgaggaacgtcgctttaacggt
tcactcgacgatctcgatgcagtgcgcgccgcggtttcagtaccggtgttgcgcaaagac
tttgtggtgcagccatatcagatccatgaggcgcgcgcgcacggtgccgatatgttgttg
ttgatcgttgctgcgttggaccaatcggcgttgatgtctatgctggaccgcaccgaatca
cttggtatgattgctctcgttgaagtccgcacggaacaggaagcggaccgggccctaaag
gcaggggccaaggtgataggtgtaaacgctcgcgatttaatgacgttggaagtggaccgg
gattgcttctcgcgaattgctcctgggttgccgagtaacgtgatcaggatcgccgaatcc
ggtgtacgtggccccgcggatctgttggcttacgctggtgcgggagcggacgccgtgttg
gtcggcgaaggcctggtgaaaagtggtgacccgcgggcagcggttgccgatctggtcacc
gcgggtacccacccgtcatgcccaaaaccggctcgctag

DBGET integrated database retrieval system