KEGG   Mycobacterium leprae TN: ML1272Help
Entry
ML1272            CDS       T00047                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mle  Mycobacterium leprae TN
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML1272 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML1272 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ML1272 (trpB)
Enzymes [BR:mle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ML1272 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1515382..1516635
Genome map
AA seq 417 aa AA seqDB search
MMPNLSCFSVAISEPTCHDPDSGGHFGGPDGYGGRYVPEALMAVIEEVTAAYEKERVNQD
FLDLLDKLQANYAGRPSPLYEATRLSEYAGSVRIFLKREDLNHTGSHKINNVLGQTLLAQ
RMGKTRVIAETGAGQHGVATATACALFGLDCVIYMGALDTARQALNVARMRLLGAEVVSV
ETGSRTLKDAINDAFRDWVTNADNTYYCFGTASGPHPFPTMVRDLQRVIGLETRRQIQYQ
AGRLPDAVTACIGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATLTGGLPGAF
QGTFSYLLQDEDGQTIESHSIAAGLDYPGVGPEHAWLRETGRAEYQPITDSEAIEAFRLL
CRTEGILPALESAHAVAGALKLASEIGKGAVIVVNLSGRGDKDIEAAAKWFGLLGTR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgatgccgaatctatcctgttttagcgtggccatctccgaacccacttgccacgacccc
gattcgggtgggcattttggtggccccgatggttatggtggtcgctacgtccccgaagcg
ctgatggcggtgatcgaggaggtcaccgccgcttacgagaaggaacgcgttaatcaggac
ttcctggacctgctggacaagttgcaagcaaactacgctggccggccgtcgccgctatat
gaagctactcggcttagcgaatacgctggctcggtgcgcatctttctcaagcgggaagac
ttgaaccacactggttctcacaagatcaacaatgtccttggtcagacattgctggcccag
cgaatgggcaagacgcgagtgattgctgagacgggtgccggtcagcatggagtggccaca
gcgacggcgtgtgcgctgttcggcctggattgtgtgatctacatgggtgcccttgacact
gctaggcaggcactcaacgtggcgcggatgcggttgctgggtgccgaggtcgtatcggtc
gagactggctcgcgaacgctcaaggacgccatcaacgacgcgttccgggattgggttact
aatgcagataacacttactactgcttcgggactgcttcgggaccgcatccttttccgact
atggtgcgtgacttacagcgcgtcatcggtctcgagacacgtcggcaaatccagtatcag
gcgggcaggctaccggacgcggttacggcgtgcatcggcggagggtccaacgctatcggg
atcttccacgcgttcctcgatgatccgggtgtacggctggtcgggttcgaggcagctggc
gatggcgtcgagactggcaggcatgcagcgacattgaccggcggcttgcccggagcgttc
cagggaacgttctcctacttgctgcaggacgaggacggtcagaccatcgagtcccattca
atcgcagcaggtctggactatccgggggttggccccgaacacgcgtggctcagggaaacc
ggacgcgccgaataccagcccattactgattctgaggcgatagaggcgtttcgtttactg
tgtcgcaccgaaggtattttaccggccctcgagtccgcgcatgctgtagccggtgccctc
aagttggcttctgaaataggcaagggtgcggtcatagtggtgaacctttcgggtcgcggc
gataaggatatcgaggcagctgctaagtggttcggcctgctgggtaccagatga

DBGET integrated database retrieval system