KEGG   Mycobacterium leprae TN: ML1965Help
Entry
ML1965            CDS       T00047                                 

Gene name
rmlC
Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00521  Streptomycin biosynthesis
mle00523  Polyketide sugar unit biosynthesis
mle01130  Biosynthesis of antibiotics
Module
mle_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ML1965 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ML1965 (rmlC)
Enzymes [BR:mle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ML1965 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA
Motif
Other DBs
NCBI-GeneID: 909135
NCBI-ProteinID: NP_302329
Pasteur: ML1965
UniProt: Q7AQ10
Position
2349336..2349944
Genome map
AA seq 202 aa AA seqDB search
MNVKELDISGAWEITPTIHSDSRGMFFEWLTASRFSAFTGHRLDVRQANCSVSSAGVLRG
LHFAQVPPSQAKYVTCVTGSVFDVVVDIRLGSPTFGCWTSITLNDSNRKTIYISESLAHG
FLALQDNSTVMYLCSAEYNPAREHAICATDPDLAIDWPVVDGVDTHLSKRDATAPNLDDI
RASGLLPTWDETQNFIANLGSK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcaaagaactggatatctcgggcgcctgggagatcacccctactattcatagc
gattcccgcggaatgtttttcgaatggctcacagccagtaggttcagcgcattcaccggt
caccgcttagacgtccggcaagccaactgctcggtgtcctcggccggtgtgttgcggggc
ctgcatttcgctcaagtgccaccgagccaggccaaatatgttacctgcgtgaccggttcg
gtgttcgatgtcgtagtcgatatccgtttaggatcaccaacattcggctgttggacctca
attacgctcaacgactccaaccggaagaccatttatatctccgagagtctcgcacacgga
ttccttgcactgcaagataattctacagttatgtacctatgctctgctgaatacaaccct
gcgcgcgaacacgccatctgcgccacggatccggacctggcaatcgactggccggtggtc
gacggtgttgacacgcacttgtccaagcgtgatgccacagcccccaatcttgatgacata
cgcgcgtctggactactgccgacctgggatgaaacgcagaattttatcgccaacctcggc
agcaaatag

DBGET integrated database retrieval system