KEGG   Mycobacterium leprae TN: ML1965Help
Entry
ML1965            CDS       T00047                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mle  Mycobacterium leprae TN
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:mle00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mle00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2349336..2349944
Genome map
AA seq 202 aa AA seqDB search
MNVKELDISGAWEITPTIHSDSRGMFFEWLTASRFSAFTGHRLDVRQANCSVSSAGVLRG
LHFAQVPPSQAKYVTCVTGSVFDVVVDIRLGSPTFGCWTSITLNDSNRKTIYISESLAHG
FLALQDNSTVMYLCSAEYNPAREHAICATDPDLAIDWPVVDGVDTHLSKRDATAPNLDDI
RASGLLPTWDETQNFIANLGSK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcaaagaactggatatctcgggcgcctgggagatcacccctactattcatagc
gattcccgcggaatgtttttcgaatggctcacagccagtaggttcagcgcattcaccggt
caccgcttagacgtccggcaagccaactgctcggtgtcctcggccggtgtgttgcggggc
ctgcatttcgctcaagtgccaccgagccaggccaaatatgttacctgcgtgaccggttcg
gtgttcgatgtcgtagtcgatatccgtttaggatcaccaacattcggctgttggacctca
attacgctcaacgactccaaccggaagaccatttatatctccgagagtctcgcacacgga
ttccttgcactgcaagataattctacagttatgtacctatgctctgctgaatacaaccct
gcgcgcgaacacgccatctgcgccacggatccggacctggcaatcgactggccggtggtc
gacggtgttgacacgcacttgtccaagcgtgatgccacagcccccaatcttgatgacata
cgcgcgtctggactactgccgacctgggatgaaacgcagaattttatcgccaacctcggc
agcaaatag

DBGET integrated database retrieval system