KEGG   Mycobacterium leprae TN: ML2069Help
Entry
ML2069            CDS       T00047                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00620  Pyruvate metabolism
mle00630  Glyoxylate and dicarboxylate metabolism
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01120  Microbial metabolism in diverse environments
mle01200  Carbon metabolism
Module
mle_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ML2069 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ML2069 (glcB)
Enzymes [BR:mle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ML2069 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 908958
NCBI-ProteinID: NP_302379
Pasteur: ML2069
UniProt: O32913
Structure
PDB: 

Jmol
Position
2457996..2460191
Genome map
AA seq 731 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNNEALPGTDINPNSFWSGVAKVVADLTPQNQSLLNSRDEL
QAQIDKWHRHRVIEPFDVDAYRQFLIDIGYLLPEPDDFTISTSGVDDEITMTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDTIPETEGAEKGSEYNKIRGDKVIAYARKFMDQAV
PLASDSWTNATGVSIFDGQLQIAIGTNSTGLASPEKFVGYNRQLRSSNWSVLLANHGLHI
EVLIDPESPIGKTDPVGIKDVILESAITTIMDFEDSVTAVDADDKVRGYRNWLGLNKGDL
TEEVNKDGKTFTRVLNADRSYTTPDGGELTLPGRSLLFVRNVGHLTTSDAILVDGGDGQE
KEVFEGIIDAVFTGLAAIHGLKTGEANGPLTNSRTGSIYIVKPKMHGPAEVAFTCELFSR
VEDVLGLPQGTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAG
PMIRKGAMKNSTWIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKA
GATTAWVPSPTAATLHAMHYHQVDVAAVQQELTGQRRATVDQLLTIPLAKKLAWAPEEIR
EEVDNDCQSILGYVVRWVDQGIGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVITS
EDVRASLERMAPLVDQQNAEDPAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILH
RRRREFKAQNR
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcgtgtcggcggggaatttgcgcgtcgcccgtgtgctttacgacttcgtc
aacaacgaagccctgcctggcaccgacatcaacccaaacagcttctggtcgggcgtcgcc
aaggtcgtcgccgacctcaccccgcaaaaccaaagtttgctgaactcccgcgatgagctg
caggcccagattgacaaatggcaccgccatcgtgtgatcgagccattcgacgtggatgct
tatcggcagttcctcatcgatatcggctatctgctgcctgaacccgatgacttcaccatc
agcacctcaggagtagacgacgagatcaccatgaccgccggcccgcagctggtggtgccg
gtacttaacgcacggttcgcactcaacgccgccaacgcccgctggggctccctttacgac
gctctatatggcaccgacaccataccggaaaccgagggagccgaaaagggctctgagtac
aacaagattcgcggcgacaaggtgatcgcctacgcacgcaagtttatggatcaggccgtc
ccgctggcttctgactcatggactaacgctacgggagtgagcatcttcgacggccagctt
cagatcgccatcggcacgaattccaccggattagccagtcccgaaaagtttgtcggctac
aatcgccagttgcgatcctccaactggtcggtgctgttggccaatcacggcctgcacatc
gaggtcttgatcgacccggaatcaccaataggcaagactgaccccgtcggcatcaaggat
gtgatcctggaatcggccatcaccacgatcatggacttcgaagactcagtcactgccgtc
gacgccgacgacaaggtacgcggctaccgcaactggctcggcctgaacaaaggtgactta
accgaggaagtcaacaaggacggcaagaccttcacccgcgtgctcaacgccgaccgcagc
tacaccacgcccgacggcggtgaattgaccctgcccgggcgcagcctgttgttcgtccgc
aacgtgggccatctgacgaccagcgacgcgattctcgtggacggaggtgacggtcaggaa
aaagaagtgttcgagggcatcatagatgcagtgttcaccggtctggccgcaatccacgga
ctcaaaaccggcgaagctaatggcccactgaccaacagccgcaccggttccatctacatc
gtcaagccgaaaatgcacggtcccgcggaggttgcgttcacttgcgagctgttcagccgc
gtcgaagacgtgctggggttgccgcagggcaccttgaaggtcggcatcatggatgaggag
cggcgtacgacactcaatttgaaggcgtgcatcaaggccgccgccgatcgggtcgtgttt
atcaacactggcttcttggaccgcaccggcgacgagatccacacctcaatggaggccggc
ccgatgattcgtaagggtgcgatgaaaaacagcacctggatcaaagcctacgaggacgcc
aatgttgacatcggactagccgcaggcttcaagggcaaagcacagatcggcaagggcatg
tgggcaatgaccgaattaatggctgatatggtcgagcagaagatcggccagcctaaggcg
ggcgccaccaccgcgtgggtaccctcgcccactgcggccacgctgcatgcgatgcactac
caccaggtcgacgtggctgccgtgcaacaagaactgaccggccagagacgtgccaccgtt
gaccagctgttgaccattccgttggccaagaaactggcctgggctcccgaggagatccgc
gaggaggtcgataatgactgtcagtccatcctcggttatgtggtgcgctgggtggaccag
ggtatcggttgctcgaaggtgcctgacatccacaatgtggcactaatggaggaccgcgcc
accctgcggatctcgagccagttgctagcaaactggctgcgccacggcgtaatcaccagc
gaggacgtgcgggccagcctggaacggatggcgccgttagtcgatcagcaaaacgccgaa
gacccagcatatcgcccgatggcgcctaatttcgatgacagcatcgcgttcctagcggcg
caggaactgatactgtccggcgcacaacagcccaacggctataccgagccgatcctgcat
cgccgtcgtcgcgaattcaaggcacagaaccggtga

DBGET integrated database retrieval system