KEGG   Mycobacterium leprae TN: ML2161Help
Entry
ML2161            CDS       T00047                                 

Gene name
fadB
Definition
fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mle  Mycobacterium leprae TN
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML2161 (fadB)
   01212 Fatty acid metabolism
    ML2161 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ML2161 (fadB)
   00650 Butanoate metabolism
    ML2161 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ML2161 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ML2161 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ML2161 (fadB)
   00310 Lysine degradation
    ML2161 (fadB)
   00380 Tryptophan metabolism
    ML2161 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML2161 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ML2161 (fadB)
   00281 Geraniol degradation
    ML2161 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ML2161 (fadB)
Enzymes [BR:mle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ML2161 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ML2161 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ML2161 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2569161..2571305)
Genome map
AA seq 714 aa AA seqDB search
MADTAIQWSKDADGIVTLTMNDPSRSANVMNEIYIESMGNAVDRIVAEKDSITGVVITSA
KRTFFAGGDLTAMINTGSEEAGQCFDTVETVKKQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVNILSQGTRFKPAK
AKEIGLVDELLSTVEELVPAAKAWIKANPEAHEQPWDKKSYEMPGGTPTSPGLAAILPSF
PSLLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFVSLVTGQVAKNMIQAFFL
DLQHINSGGSRPDGIGKTPIKKIGVLGAGMMGAGIAYVSAKAGYNVVLKDVSLEAAQKGK
SYSEKLEAKALERGRTTQEKSDVLLACIAPTGDPTDLKGVDFVIEAVFENQELKHKVFQE
IEDIVDPNAVLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYALAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPSSIEQAGAQAGYP
APPLQLSDELNLELMHKIAIATRKGVEDAGGMYESHPAETVVEKMIKLGRSGRLKGAGFY
EYVDGKRSGLWLGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDENVLTSTADANIG
SIMGIGFPPWTGGSAQFIAGYSGPAGTGQQAFVSRARELVAKYGDRFLPPESLL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcagacactgcaattcagtggagtaaggacgccgacggtattgtcacgctgacaatg
aacgacccgtccaggtcggccaacgttatgaacgagatttacatcgaatcgatgggcaat
gcggtggatcgcattgttgcggaaaaagattcgattaccggtgtggttataaccagcgct
aaaaggactttctttgccggcggtgacctcaccgcgatgatcaatactggatcagaagag
gccgggcaatgcttcgacactgtcgagacggtcaagaaacaattgcgcaccctggaaacg
ctgggcaagccggtcgttgccgccatcaacggtgccgcgctgggcggcggtctggagatc
gcgctcgcatgtcatcaccggatcgctgccgacgtcaagggcagtcagctcggcttgcct
gaagtgacgctggggctgttgcccggcggcggtggggtgacccgcacggtgcggatgttt
ggcatccagaacgcgttcgtcaacattctgtcacagggcacccgctttaagcctgccaag
gctaaggagatcgggctggtcgacgagctgttgtcaacagtcgaggagctggtgcccgcg
gctaaggcgtggatcaaggccaacccggaagcgcacgagcagccgtgggacaagaagagc
tacgagatgcccggtggtactccgacctcgccagggttggcggccattctgccgtcattc
ccgtcgctgttacgcaagcagctcaagggcgcgccgatgccggccccgagggccatcttg
gccgccgcggtcgagggcgcgcaggtcgacttcgacaccgccagccgtattgagagccgc
tacttcgtttcgctggtcaccggccaggtcgccaagaacatgatccaagcgtttttctta
gatctgcagcacatcaattccggtgggtctcgacccgacggcattggtaaaaccccgatc
aagaagatcggtgtgctgggtgcgggtatgatgggcgccggtatagcctacgtctcggcc
aaggcgggctacaacgtggtgcttaaggatgtgagtcttgaggccgcgcagaagggcaag
agctactcggagaagctggaagccaaggcgctagagcggggccgcactacgcaggagaag
agcgacgttctgctggcgtgcatcgccccgacaggcgaccctactgatctcaagggcgtt
gacttcgtgatcgaagccgtcttcgagaaccaggaactcaagcacaaggtgttccaggag
atcgaagacatcgtcgaccccaatgcggtactcgggtcgaacacctcgacgttgccgatt
accggtctggcgaccggcgtcaagcggcaggaggactttatcgggatccacttcttctct
ccggtcgacaagatgccgctggtcgaaatcatcaagggcgagaagacctcggacgaggca
ctggcccgggtgttcgactacgccctggctattggcaagaccccgattgtggtcaacgac
agccgcggcttcttcacttcgcgggtgatcggcacttttgtcaacgaggcgctggcgatg
ctcggtgagggggtggaaccatccagcattgaacaggcaggtgcgcaggctggctacccg
gcgccgccgctgcagttgtccgacgagctgaatctggagctcatgcacaagatcgcgatc
gctacccgcaagggtgtcgaggatgccggcggcatgtatgagtcgcacccggcagaaacc
gtggtggagaagatgattaagctcggccggtccgggcgcttgaagggtgccggcttttac
gagtacgttgacggcaagcggtccgggttgtggctcggtctgcgggagacgttcaagtcg
ggctcgtcgcagccgccgttgcaggacatgatcgaccggatgctgttcgccgaggcgctg
gaaactcagaagtgcctcgatgagaacgtgctgacgtccactgccgacgccaatatcggg
tccatcatgggtatcggtttcccgccgtggaccggtggcagcgcgcagtttatcgccggc
tactctggcccggccggtaccggccagcaggccttcgtgtcccgagcccgtgagctggtg
gccaagtacggcgatcgctttctgccgccggagtcgctgctatag

DBGET integrated database retrieval system