KEGG   Mycobacterium leprae TN: ML2329Help
Entry
ML2329            CDS       T00047                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mle  Mycobacterium leprae TN
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mle03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2760630..2761241)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQNLIDELGKLPGIGPKSAQRIAFHLLSVEPQDIDRLTAVLVKVRDDVRFCTVCG
NVSDDERCRICSDTRRDASVVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPEQ
LRIRELLSRIGERVDDVGITEVIIATDPNTEGEATATYLVRMLRDMPGLTVTRIASGLPM
GGDLEFADELTLGRALTGRRTMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaggggccggtccagaatctgattgacgagcttggcaagctgcctggtattgga
cctaaaagcgcgcagcgcatcgcctttcacctgttatcagtggaaccgcaagatatcgac
cggttgacagccgtgttggtaaaggttcgcgatgacgtgcggttctgtacggtgtgcggc
aatgtatctgacgacgagcgatgcagaatttgttctgatacccgtcgagatgcatctgtg
gtgtgcgtggttgaggaaccgaaagatgtccaggccgtggagcgcacccgcgaattccgc
ggccgctatcacgtgttgggcggtgcgcttgatccgctatccggaattggtcccgagcag
ctgcggatccgcgagttgctaagccgcatcggtgagcgggtcgacgatgtgggcattaca
gaggtgatcattgccaccgaccccaataccgagggtgaggcaaccgccacctatttggtt
cggatgctgcgcgatatgcccggcttgaccgtgacgcggatcgcgtccggcttgccgatg
ggcggcgacctggaattcgccgacgagctgacactcggccgtgcgctgaccggccggcga
acgatggtctga

DBGET integrated database retrieval system