KEGG   Mycobacterium leprae TN: ML2420Help
Entry
ML2420            CDS       T00047                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00860  Porphyrin and chlorophyll metabolism
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ML2420 (hemD)
Enzymes [BR:mle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ML2420 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ML2420 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase T_hemolysin
Motif
Other DBs
NCBI-GeneID: 908323
NCBI-ProteinID: NP_302565
Pasteur: ML2420
UniProt: Q9CB60
Position
complement(2894835..2896526)
Genome map
AA seq 563 aa AA seqDB search
MVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPDVPEPVLALIG
KDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMSGGADIRPALGDPTEVAKTLT
AEARSGVDVVRLVAGDPLTVDAVIAEVNAVARTNLQIEIVPGLVTSSVVPTYAGLPLGSS
HTVADVRGDVDWEALAAAPGPLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQ
RSVETTLEGLADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR
TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVVFTSTNAVR
AVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPELVPAGEQSSLGLLDEFPPYD
SVFDPVNRVLLPRADIATETLAEGLRGCGWEIEDVTAYRTVRAAPPPAATREMIKTGGFD
AVCFTSSSTVRNLVGIAGKPHARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDAL
AEHVARLRAEGALPPPRKKSRRR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggagcgacaatgacgacgcgagggcgtaagcttagaccaggtcgcatcacattt
gtgggcgccggtccaggagccccagggttactaactgctcaggctgtagcggtgctagca
aacgccgcccttgtttttatcgaccccgatgtacctgaaccggtgctggcgctgattggc
aaggacttgccaccggtctctggtccggcgcctgccggtccggctgccgtgaccgccggc
agggctgctgacggtaccctcgagggggatcactaccaagccgcaccgatggtcatgtcc
ggaggcgccgacatccgccctgcgttgggtgaccctactgaggtcgccaaaacgctgacc
gccgaggctcgttccggtgttgatgtggtgcgcttagtggcgggtgatccgttgacggtg
gacgcggtcatagccgaggtgaacgctgtggcacgcaccaatctacaaatcgagatcgtg
cccggcttggtcaccagcagcgtcgtaccaacctatgccgggctacccttgggttcgtcg
cacacggtggctgatgtacgtggcgacgtggactgggaagcgctagccgcggctcctggg
ccgttgattctgcaagccaccgcatcacatcttgccgacgcggcgcacatcttgatcgac
cacgggctggacgacgccacaccctgcgtggtgaccgctcagggcacgacctgccagcaa
cgttctgtcgaaaccacattggagggattggctgactcggctgtcctggtcggcaccgat
accgcaggcccgctgaccgggccgctggtggtgaccataggcaagacggtgaccagtcga
gctagactgaactggtgggaaagccgtgcactctacggctggaccgtgttggtaccgcgt
accaaggaccaggccggcgagatgagcgagcggctgacgtcgtacggtgcgttgccggtt
gaggtgccgaccatcgctgtcgagccgccgcgcagtcccgctcagatggaacgtgctgtc
aaggggctggtcgacggtcgtttccaatgggtggtgttcacctccaccaacgcggtgcgc
gcggtgtgggagaagtttggcgagttcggtctggatgcccgcgccttctccggggtgaag
atcgcctgtgtcggagaagcgactgccgacagggtccgtgcattcgggatcagcccggag
ctggtgccggctggggaacagtcttccctcggtctactggacgaattcccgccttatgac
agcgttttcgacccggtgaaccgtgttttgctgccgcgcgctgacattgccaccgaaacc
ctggctgagggactgcgcgggtgtggctgggagatcgaggacgtcaccgcttatcggacg
gtgcgggcggcaccgccgccggcggccacccgggaaatgatcaagacgggtggcttcgat
gcagtgtgcttcacctccagctccacggtgcgtaacttggttggtattgccggcaaaccg
cacgcgcggacggtcattgcctgcatcggacccaagactgctgagaccgcttccgaattt
ggtttgcgggtggatgtccagcccgaaaccgccgcggttggaccgttagttgatgcgttg
gccgaacatgtcgctcgactgcgcgccgaaggcgcgctgcctccaccgcgcaagaagagc
cgcaggcgctag

DBGET integrated database retrieval system