KEGG   Mycoplasma leachii 99/014/6: MLEA_000080Help
Entry
MLEA_000080       CDS       T02144                                 

Gene name
recM
Definition
DNA repair protein RecM
Orthology
K06187  
recombination protein RecR
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mlh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MLEA_000080 (recM)
DNA repair and recombination proteins [BR:mlh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MLEA_000080 (recM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7855..8445
Genome map
AA seq 196 aa AA seqDB search
MPESIFNEIVESIRTNEGLTKKTSERLLVNLLLNKDKLNEFINQLNKVSQLISTCKICGY
LSENEKCLVCSLDNRNQNIICIVSTILDAKNIETANKYKGVYHILNGEINLNKNITFDKL
NISSIFKRVNDNTEIILALNSTFEGELTANYLYKLLSTKNVKITRLAKGMPMGASLDYMD
EFTLQSAFINRKKYGE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagtatatttaatgaaattgtagaatcaattagaactaatgagggattaact
aaaaaaacttcagaaagattattagtgaatttgttattaaataaagataaacttaatgaa
tttattaatcaactaaataaagttagccaactaatttcaacttgtaaaatatgtggatat
ttaagtgaaaatgagaaatgtttagtatgtagtttagataatagaaatcaaaatataatt
tgtatagtttcaacaattttagatgcaaaaaacatagaaactgcaaataagtataaagga
gtttatcatattttaaatggtgaaattaatctaaataaaaacattacatttgataagtta
aatattagttctatttttaaaagagttaatgacaatactgaaattattttagctttaaac
tctacttttgaaggcgaactaactgctaattatttatataaactactaagtactaaaaat
gttaaaatcacaagattagccaagggaatgccaatgggggctagtttagattatatggat
gaatttactttacaaagtgcatttattaatagaaaaaaatatggagaataa

DBGET integrated database retrieval system