KEGG   Mycoplasma leachii 99/014/6: MLEA_000730Help
Entry
MLEA_000730       CDS       T02144                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MLEA_000730
   00052 Galactose metabolism
    MLEA_000730
   00500 Starch and sucrose metabolism
    MLEA_000730
   00520 Amino sugar and nucleotide sugar metabolism
    MLEA_000730
Enzymes [BR:mlh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MLEA_000730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83808..84686
Genome map
AA seq 292 aa AA seqDB search
MKIRKAIIPCAGFGTRFLPFTKSQAKEMLPIIDKPAIEFIVQEAINSGIEEILIIIRAGK
NHIVNHFSRNIELEYFLTEKNKISELQLISEKYNATIYYLIQEEQLGLGHAISLAKDFIK
DEPFAVLLGDDLFKCKTPAIKQLIDIYDRYHQNVLGTIYIDKQNSKKYGICQGNQISEDV
YKVDLVVEKPEPENSPSNIAIGGRYVLLPEIFKYLDMKIKDKSGEIQLTDSILKTMDESE
CYAKIIDGSRYDIGNKLGYLDAILDFGLEREDLKEEFLDLIKTKVEKTSSNN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagccatcattccttgcgctggatttggtactagatttttacctttt
actaaatcacaagcaaaagaaatgctacctataatagataaacctgctatagaatttatt
gttcaagaagcaataaatagtggaattgaagaaattttaattataatacgtgctggaaaa
aatcacatagtcaaccattttagtagaaatattgaattagaatactttttaacagaaaaa
aataagataagtgaattacaactaataagtgaaaaatataacgcaacaatttattatcta
attcaagaagaacaacttggtttaggacatgctatttctttagcaaaagattttataaaa
gatgaaccatttgctgtgttgttaggtgatgatttatttaaatgtaaaaccccagctatt
aaacaattaatagatatttatgataggtatcatcaaaatgttcttggtactatttatatt
gataaacaaaatagtaaaaaatatggaatttgtcaaggtaatcaaatttcagaagatgtt
tataaagttgatttagttgttgaaaagccagaaccagaaaattctccaagtaatattgca
attggtggtagatatgttttattacctgaaatatttaaatatttagatatgaaaataaaa
gataaaagtggtgaaatccaactaactgattcaattttaaaaacaatggatgaatctgaa
tgttatgctaagataattgatggttcaagatatgatattggaaataaactaggttatctt
gatgctattttagattttggtttagaaagagaagatttgaaagaagagtttttagattta
ataaaaactaaagttgaaaaaacatcatcaaacaactag

DBGET integrated database retrieval system