KEGG   Mycoplasma leachii 99/014/6: MLEA_001020Help
Entry
MLEA_001020       CDS       T02144                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
mlh00010  Glycolysis / Gluconeogenesis
mlh00052  Galactose metabolism
mlh00500  Starch and sucrose metabolism
mlh00520  Amino sugar and nucleotide sugar metabolism
mlh00521  Streptomycin biosynthesis
mlh01100  Metabolic pathways
mlh01110  Biosynthesis of secondary metabolites
mlh01120  Microbial metabolism in diverse environments
mlh01130  Biosynthesis of antibiotics
mlh01200  Carbon metabolism
Module
mlh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mlh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLEA_001020
   00052 Galactose metabolism
    MLEA_001020
   00500 Starch and sucrose metabolism
    MLEA_001020
   00520 Amino sugar and nucleotide sugar metabolism
    MLEA_001020
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MLEA_001020
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MLEA_001020
Enzymes [BR:mlh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MLEA_001020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Glucokinase TIMP Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: CBV66843
Position
complement(118568..119533)
Genome map
AA seq 321 aa AA seqDB search
MKKILGVDLGGTSAKVGIISQNGDLEHSFSITNPKTKIIENLYFEIQKTLKTLNIDEKNI
MLVGITAPGFVDHNKGIVIMAPNIENGWFNYDLKTEAEFLFKKPVYVINDVNAAALGEYK
KGSGLVYKSGLFYWLGTGIGGAIISNGKLISGSHGFAGEFGHGGSNQYNLKCNCGLNNCI
EKVCSATTIPNSLLKILNNKYPEFYQKHFSNIKNLDMKLLFEIYNNLNKPIELKNSLLEV
YNELFNHMSLLIHALDPDVVIIGGGGSLAGNNLLEIFEFGVRNKLTNSYKDIVDFKLALL
KNDAGMIGAAFYALEQSLKAS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaggagtagatcttggtggaacttcagcaaaagttggaattatttca
caaaacggagatttagaacatagtttttctataactaatccaaaaactaaaattatagaa
aacttatattttgaaattcaaaaaactttaaaaacactaaacatagatgaaaaaaacatt
atgttagttggaataacagctcctggatttgttgatcataataaaggaattgtaattatg
gctccaaatattgaaaatggatgatttaattatgatttaaaaactgaagctgaattttta
ttcaaaaaacctgtctatgtaattaatgatgtaaatgctgctgcacttggtgaatacaaa
aaaggatcaggactagtttataaatcaggtttattttattgattggggactggaattggt
ggagctataatttctaatggaaaactaatttcaggatcacatgggtttgctggagaattt
ggacacggtggaagtaatcaatacaatttaaaatgcaattgtggattaaataattgtatt
gaaaaagtatgttcagctacaactataccaaactcacttttaaaaattttaaataacaaa
tatcccgaattttatcaaaaacatttttcaaatattaaaaatttagatatgaaactttta
tttgaaatctataacaatttaaataaaccaatagagttaaaaaatagtttattagaagtt
tataatgaattattcaatcatatgtcattattaatacatgctttagatccagatgtagtt
attattggtggtggtggttctttagctggaaataatttattagaaatatttgaatttggt
gtaagaaataaattaacaaattcatataaagatatagttgattttaaattagctttatta
aaaaatgatgccggaatgatcggtgctgctttttatgctttagaacaatcactaaaagca
agttaa

DBGET integrated database retrieval system