KEGG   Mycoplasma leachii 99/014/6: MLEA_002450Help
Entry
MLEA_002450       CDS       T02144                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mlh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MLEA_002450 (ruvA)
Enzymes [BR:mlh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MLEA_002450 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(287234..287794)
Genome map
AA seq 186 aa AA seqDB search
MNDYINAFLHKIDDKFLYLELNNLGYRYLYLKRDLKNFKLSENNKIYIATNVIDNLFKCY
GFYNQLVRDLFEILININTIGEKTAFLILENYSYEELIDIFKNAKTDKILQLKGIGSYTA
RLIINSVQKELFNNKISEKKNKVITSLEKLGYKTKDIYKIIINIDEDLTIDELTKYVLEK
LSYINN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattatatcaatgcttttttacataaaatagatgacaaatttttatatttagaa
ttaaataatttgggttatagatatttgtatttaaaaagagatcttaaaaattttaaatta
agtgaaaataataaaatttatatagcaactaatgtgattgataatctttttaaatgttat
ggtttttataatcaactagtaagagatctttttgaaattttaataaatattaatacaatt
ggagaaaaaactgcttttttaattttagaaaactacagttatgaagaattaattgatatt
tttaaaaatgctaagactgataaaattttacaacttaaaggaataggaagttatacagca
agactaattataaatagtgttcaaaaagagttatttaataataaaataagcgaaaagaaa
aataaagtaattacaagcttagaaaaattaggctataaaacaaaagatatttataaaatc
atcattaatattgatgaagatttaactatagatgaactaacaaaatatgttttagaaaaa
ctaagttatataaataattaa

DBGET integrated database retrieval system