KEGG   Mycoplasma leachii 99/014/6: MLEA_004540Help
Entry
MLEA_004540       CDS       T02144                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mlh00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536247..537140
Genome map
AA seq 297 aa AA seqDB search
MKKGKMIIISGPSGVGKGSVNGELLQNPDLRLKYSVSMTTRKPRNDEINGVNYFFVSNEE
FAKAIVNDELIEYAHFVGNSYGTPRKYVEQELKKGNNVILEIEVDGATQVLNKEANVLSI
FLMPPNLAELANRIRGRQTEDEEKIKARLDKALLEIPLKHNYQYVIENDNVPNAVAKITD
VLHLEGLTDIKTPTVYERLEQIVEQIVKEKYMYFVNNWETNVKLLAKNEEEKNKAKNFDA
ETYLIKLLTKKVYHKVLGHGDFSKLLDKDFVDFKIQKLMFKINFFSVEQKHYNNDDF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtaaaatgatcataatttcaggaccaagtggagttggtaaaggttcagtt
aatggagaacttttacaaaatccagatctacgtttgaaatattcagtttcaatgacaaca
agaaaacctagaaatgatgaaattaatggagtaaactatttttttgtttcaaatgaagaa
tttgcaaaggccattgttaatgatgaattaattgagtatgcacattttgttggtaattct
tatggtactcctagaaaatatgttgaacaagaattaaaaaagggtaataatgttatttta
gaaattgaagtagatggggctactcaagttttaaataaagaagcaaatgttttatctatt
tttttaatgcctccaaatctagctgaactagctaatagaattagaggaagacaaactgaa
gatgaagaaaaaataaaagcacgactagataaagctttattagaaattcctttaaaacac
aattatcaatatgtaattgaaaatgataatgtacctaacgctgttgcaaaaattactgat
gttttacatttagaaggtttaactgatataaaaactccaactgtatatgaaagattagaa
caaattgttgaacaaattgttaaagaaaaatatatgtattttgttaataattgagagact
aatgttaaattattagctaaaaatgaagaagaaaaaaataaagctaaaaactttgatgct
gaaacttatttaattaaattattaactaaaaaggtatatcacaaagttttaggacatggt
gatttttctaaattactagataaagattttgttgattttaaaattcaaaaattaatgttt
aaaattaatttctttagtgttgaacaaaaacattataataatgatgacttctag

DBGET integrated database retrieval system