KEGG   Mycoplasma leachii 99/014/6: MLEA_004700Help
Entry
MLEA_004700       CDS       T02144                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mlh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(551232..552749)
Genome map
AA seq 505 aa AA seqDB search
MTDSKKYILTLDEGTTSARALITDKQGNIIAVEQSEFTQYFPKEGWVEHDAIEIWNTQRS
ALVQVLNKSGIDPSQIEAIGITNQRETAVIWNKETGLPIYNAIVWQDQRTADYCQTFDKD
TLEMVKQRSGLIINPYFSGTKVKWILDNVPNARQLAKEGKLMFGTINTWLIYRLTGGEVF
VTDHTNAQRTLLYNIHTNDWDDELLKLFDIPRNILPEIKSCSEVYGYTFKGLFSKGNEQR
IKIASSIGDQQSALFGQLCLEKGQVKVTYGTGCFILTNTGEEIVKSNHGLLTTVAYSFKD
KVYYALEGSVMIAGAAVQWLRDNLRIVYNAIETEWYAGQVKDDRRVYVVPSFTGLGSPYW
DSFSRGAIFGLDRGTRREHIVRATLEAIAYQANDVVDAMGKDMKKPIEIFKVDGGAANNK
FLMQFQSNISQSKVIKPTNVETTAMGAAFMAGLAVGYWENVEELKKTYKVHFELTPELSK
PEVDKLIKGWKVAVQRTFKWVEEIE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagtaaaaaatacattttaacactagatgaaggaacaacaagtgcaagagct
ttaattactgataaacaaggtaatattattgctgttgaacaatcagaatttactcaatac
tttccaaaagaaggatgagtagaacatgatgctattgaaatttgaaatactcaacgttct
gcattagtacaagttttaaataaatctggaattgatccaagtcagattgaagcaattgga
attactaatcaacgtgaaactgctgttatttgaaataaagaaactggattaccaatttat
aatgctatagtttgacaagatcaaagaacagctgactattgtcaaacatttgataaagat
actttagaaatggtaaaacaaagatctggattaataattaatccatacttttcaggaact
aaagtaaaatgaattttagataatgttccaaacgctagacaactagcaaaagaaggaaag
ctaatgtttggaacaatcaacacatgattaatttatcgtctaacaggtggagaagtattt
gtaacagatcatactaacgcacaaagaactttactatacaatattcacacaaatgactga
gatgatgaattattaaaattatttgatattccaagaaacattcttcctgaaattaaatca
tgtagtgaagtttatggttacacatttaaaggtctattttctaaaggcaatgagcaaaga
atcaaaattgcatcatcaattggtgatcaacaaagtgctttgtttgggcaattatgctta
gaaaaaggtcaagtaaaagtaacttatggaacaggatgctttattttaacaaatactggt
gaagaaattgttaaatcaaatcatggtttattaacaacagttgcttattcatttaaagac
aaagtatattatgctttagaaggttcagtaatgattgctggagctgctgttcaatgatta
agagataatctaagaattgtttataatgctattgaaacagaatgatatgctggtcaagtt
aaagatgatagaagagtttatgttgttccatcatttactggattaggttctccttattga
gattcattctcacgtggtgctatttttggactagatcgtggaactagacgtgaacatatt
gttagagcaactctagaagctattgcataccaagcaaatgatgttgttgatgcaatggga
aaagatatgaagaaaccaatcgaaatttttaaagtagatggtggggctgcaaataacaaa
ttcttaatgcaattccaatcaaatatttctcaatctaaagttataaaaccaacaaacgta
gaaactactgctatgggagctgcatttatggcaggattagctgttggatattgagaaaat
gttgaagaattgaaaaaaacttataaagttcactttgaattaacaccagaactaagtaaa
ccagaagttgataaattaattaaaggttgaaaagtagctgttcaaagaacatttaaatga
gtagaagaaattgaataa

DBGET integrated database retrieval system