KEGG   Mycoplasma leachii 99/014/6: MLEA_004720Help
Entry
MLEA_004720       CDS       T02144                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mlh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLEA_004720 (pfk)
   01230 Biosynthesis of amino acids
    MLEA_004720 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLEA_004720 (pfk)
   00030 Pentose phosphate pathway
    MLEA_004720 (pfk)
   00051 Fructose and mannose metabolism
    MLEA_004720 (pfk)
   00052 Galactose metabolism
    MLEA_004720 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MLEA_004720 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MLEA_004720 (pfk)
Enzymes [BR:mlh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MLEA_004720 (pfk)
Protein phosphatases and associated proteins [BR:mlh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MLEA_004720 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554270..555250
Genome map
AA seq 326 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAIAGVVKTAASKGIEVYGINDGYKGLVNGWFEKLNVEKTLD
ILSRGGTYLGSARLPEFKELEVRQKAVANLKKAGIEALVVIGGDGSYMGAQKLTEMGINC
IGLPGTIDNDISSTDYTIGFHTALNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTY
TAVATGAEIFSPAEDLLTIEQMGQKAKQFRLLGKKSLIILVSEKSYGISAEEIAEKIQKI
SGYETKATVLGHIQRGGRPTAMDRYIAFTAGMFAVEKLAEGKGGLFIGLENNKLVARDID
STLNMKKEDKKPFIKYLREINGYFSK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaattggaattttgacttctggaggggatgctcctggaatgaataatgcc
attgctggagttgtaaaaacagcagcttcaaaaggaattgaagtatatgggattaatgat
gggtataaaggattagttaatggttgatttgaaaaactaaatgttgaaaaaactttagat
attctttcaagaggtggaacttatttaggatctgcaagattaccagaatttaaagaatta
gaagtaagacaaaaagcagtagctaatctaaaaaaggctggaattgaagctttagttgta
attggtggagatggtagttacatgggtgctcaaaaattaactgaaatgggcattaattgt
attggtttacctggaactattgataatgatatttcttcaactgattatactattggtttt
catactgcattaaatacaattgttgaagcagttgatagaattagagatacaatgcaatca
cacaatagagcagacgttgttgaaattatgggaaatggttgtggtgatttagtaacttat
actgcagttgctacaggagctgaaattttttcaccagctgaagatctactaacaattgaa
caaatgggtcaaaaagcaaaacaatttagattattaggtaaaaaaagtttaattatttta
gtttcagaaaaatcatatggaatttcagctgaagaaattgctgaaaaaattcaaaaaatt
agtggttatgaaactaaggcaactgttttaggacatattcaacgtggtggtagaccaact
gctatggatagatatattgcttttacagcaggtatgtttgctgttgaaaaattagctgaa
ggtaaaggtggattatttatcgggttagaaaataataaattagttgcaagagatattgat
tcaactttaaatatgaaaaaagaagataaaaaaccatttattaaatatttaagagaaatt
aatggatattttagtaaataa

DBGET integrated database retrieval system