KEGG   Mycoplasma leachii 99/014/6: MLEA_004800Help
Entry
MLEA_004800       CDS       T02144                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mlh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mlh00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mlh00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mlh00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564147..565466
Genome map
AA seq 439 aa AA seqDB search
MFKVKFADIGEGLTEGTVAEVLVKVGDVVKEGQSLYFVETDKVNSEIPAPVAGKIAVINI
KAGQEIKVGDVVMEIDEGTGASVASEPKAEAKSEAKVEVVEENASVVGATPVSNDLIVRK
QASTVTKSSTIKATPLARKVAADLNVDLSLVTPTGPNQRILVADIKNYHSSSAQPVSQPA
PAPIPTVSQPAPAPVVTPTIKVVEPSAPLSWDEVPMNGVRKATVKAMTKSHTEIAAFTGM
KNTDITETHKMRTELKDHAAASGIKLTYLAFIIKAVAKSLRDMPNINVRGDFANNKIQFM
HNINIGIAVDTPNGLMVPVIKGADHLSVFEIAIKINELANKAKDGKLARAEMTEATFTVS
NFGSVGLDYATPIINSPESAILGVGTMSQTPLYINGELQKRFIMPLSMTCDHRIIDGADA
GRFLIKVQDYLSKPVLLFM
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagttaaatttgctgacataggtgaaggtctaacagaaggaacagtcgctgaa
gttttagttaaagttggtgatgttgttaaagaaggacaatcattatactttgttgaaact
gataaagtaaacagtgaaatacctgctccagtggctggaaaaattgcagtaattaacatt
aaagctggacaagaaatcaaagttggtgatgtagttatggaaattgatgaaggaacaggt
gcatctgtagctagtgaaccaaaagctgaagctaaatcagaagctaaagttgaagtagtt
gaagaaaatgctagtgtagttggtgctactccagtttcaaatgatttaattgttagaaaa
caagcatctacagttacaaaatcaagcactattaaagctacacctctagcaagaaaagtt
gctgctgatctaaatgttgatttatctttagtaactccaacaggaccaaaccaaagaatt
ttagttgctgatattaaaaactatcattcttcatcagctcaaccagttagtcaaccagct
ccagctccaattccaactgttagtcaaccagctccagctccagttgtaactccaacaatt
aaagttgttgaaccaagtgcacctttatcttgagatgaagttccaatgaatggtgttaga
aaagctacagtaaaagcaatgacaaaatcacatactgaaattgctgcatttactggtatg
aaaaacactgatattactgaaactcacaagatgagaactgaattaaaagatcatgctgca
gctagtggaattaaattaacttacttagcatttattattaaagctgttgctaaatcatta
cgtgatatgccaaatattaatgtaagaggtgattttgcaaacaacaaaattcaatttatg
cacaacattaatattggaattgcagtagatacaccaaatggattaatggttccagttatt
aaaggtgctgatcacttaagtgtatttgaaattgcaatcaaaattaatgaattagcaaac
aaagctaaagatggtaaattagcaagagctgaaatgactgaagcaacatttactgtttca
aactttggttcagtaggactagattatgctactcctattattaactcaccagaatcagct
attttaggagttggtacaatgtctcaaactcctttatatatcaatggtgaattacaaaaa
agatttataatgccattatcaatgacttgtgatcatagaatcattgatggtgcagatgct
ggaagatttttaattaaagtacaagattatctatcaaaaccagtactattgtttatgtaa

DBGET integrated database retrieval system