KEGG   Mycoplasma leachii 99/014/6: MLEA_009100Help
Entry
MLEA_009100       CDS       T02144                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mlh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988269..989657
Genome map
AA seq 462 aa AA seqDB search
MFKFKKDFWWGAASSGCQTESDKDKPNLNIMDYWYKQTPTDFYDNKGPNITCDTYSNYKT
DVKLMSEIGLNSFRTSIQWTRLIKNLYTGEVDLKQVEFYRNYFLEIKKNNIKLIVNLFHF
DTPIELENIGGWTNKKTVELYFLYAKQCFKYFSDLVDYWTTFNEPIVLVDGCYLNKWYYP
KISNLKLVIQAAYNTILAHCKVANYFHSYFKNDQNKKISIILNLTPTIPKNSESKHLKAA
KIRDELLNKSFLNAVIKGQFSNFLIKFLNENNLMPEYDQLELNEIKKTRIDFLAVNYYQP
ARVQAPNNNLDNPKDLKLENWFEVYVDKKSRINPYRGWEIHPQTLYDIAIDIKNNYDNIP
WIVSENGIGVSDENRFLNKQGYIDDQYRIDFIKEHLIYLYKAIEQGSNCFGYHMWTLIDN
WSWANGFKNRYGFISLDTKTLKRTIKKSGYWIKQVIKDQGFE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttaaaaaagatttttggtgaggtgctgctagttctgggtgtcagactgaa
tcagataaagataaaccaaatttaaatattatggattattgatacaaacaaacaccaaca
gatttttatgataataaaggacctaatattacttgcgatacttattctaactataaaact
gatgttaaattaatgagtgaaattggattaaacagttttagaacttctattcaatgaaca
agattaataaaaaatttatatacaggtgaagttgatttaaaacaagtagagttttataga
aattattttttagaaattaaaaaaaataatattaaattaattgttaatttatttcatttt
gatacacctattgaattagaaaatattggtggttgaactaataaaaaaacagtagaatta
tattttttatatgctaaacaatgttttaaatattttagtgatttagttgattattgaaca
acatttaatgaacctatagttttagtagatggatgttatttaaataagtgatattatcca
aaaattagtaacttaaaattagtaattcaagcagcatacaacacaatactagctcattgc
aaagtagctaattattttcattcttattttaaaaatgatcaaaataaaaaaatatcaata
atattaaatcttactccaacaataccaaaaaatagtgaatcaaaacatttaaaagcagca
aaaattagagatgaattacttaataaatcttttttaaatgcagttataaaaggacaattt
agtaattttttaatcaaatttttaaatgaaaataatttaatgcctgaatatgatcaatta
gaattaaatgaaattaaaaaaacaagaattgattttttagctgtgaattattatcaacca
gcaagagtacaagcaccaaacaataatttagataacccaaaagatttaaaactagaaaat
tgatttgaagtatatgttgataaaaaaagtagaattaatccttatagaggttgagaaatt
cacccacaaacactatatgatatagctatagatattaaaaataattatgataatatacct
tgaatagtttcagaaaatggaattggtgtgagtgatgaaaataggtttttaaacaaacaa
ggttatattgatgatcaatatcgtatagattttataaaagaacatttaatttatttatat
aaagcaatagaacaaggttcaaattgttttggttatcatatgtgaacattaattgataat
tgaagctgagctaatggttttaaaaatagatatggttttataagtttagatacaaaaaca
ttaaaaagaacaattaaaaaatcaggttattgaattaaacaagtaattaaagatcaagga
tttgaataa

DBGET integrated database retrieval system