KEGG   Mycobacterium liflandii: MULP_00090Help
Entry
MULP_00090        CDS       T02444                                 

Gene name
celA
Definition
cellobiohydrolase a (1,4-beta-cellobiosidase a) CelA (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mli  Mycobacterium liflandii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MULP_00090 (celA)
Enzymes [BR:mli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MULP_00090 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94936..95949
Genome map
AA seq 337 aa AA seqDB search
MSSAFGALARRIAPFLAVSAAAYLAFFAAPAPVVPAPPMTLVDGANPLAGQPFYVDPGSA
AMVAARNANPPSPELNAIANTPQSYWLDQAFPASTVGGTVARQTGAAQAAGAMPILTLYG
IPHRDCGSYASGGFATGADYRAWIDAISSGLGSAPAAIIVEPDALAMADCLSADQRQERF
DLVRYAVNTLTRDPAAAVYVDGGHSRWVSAEEMAARLNQVDVGHARGFSLNISNFYTTDE
EIGYGEAISGMTNGSHYVIDTGRNGVGPAPESPLNWCNPDGRALGVAPTTATAGAHADAY
LWIKRPGESDGSCGRGEPQAGHFVSQYAIDLAHNAGQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagcttttggcgcactcgcacgccggatcgcccccttcctggccgtttcggcc
gccgcatacctggcgttttttgccgccccggcgccggtcgttccggccccgccgatgacc
ctggtcgacggggcaaacccgctggccgggcagcctttctacgtcgatcccggctcggcc
gcaatggtcgcggcgcgcaacgccaacccgccgagtcctgagctgaacgccatcgccaac
accccacagtcctactggctcgaccaagcgttcccggcctccaccgtcggcggcacggtt
gccaggcagaccggtgccgcgcaggccgccggcgccatgccgattctgacgctctacggg
atcccgcatcgtgactgcggaagctacgcatcgggtgggttcgcgacgggtgccgactac
cgcgcatggatcgacgccatctcgtcgggcctgggctcggcgcccgcggcgatcatcgtc
gaacccgatgcgctggccatggccgactgcctttcggccgaccagcgccaggaacgcttc
gacttggtgcgctacgccgtcaacacgctgacccgtgatccggccgctgccgtctacgtc
gatggcgggcattcgcgctgggtgagcgccgaggagatggctgcccggctcaaccaggtc
gatgtgggccacgcgcggggtttcagcctcaacatctcgaacttctacaccaccgatgag
gaaatcggctacggcgaggcgatatcggggatgacgaacggttcgcactacgtgatcgac
acgggccgaaatggtgtcggcccggccccggagtccccgctcaactggtgcaaccctgac
ggccgcgccctgggcgtggcgcctaccaccgccaccgccggcgcgcatgccgacgcgtac
ttgtggatcaagcgtccgggtgagtccgacgggtcatgcggccgcggtgagcctcaggcg
ggtcacttcgtcagccagtacgccatcgacctggcccacaacgcgggccagtag

DBGET integrated database retrieval system