KEGG   Mycobacterium liflandii: MULP_00505Help
Entry
MULP_00505        CDS       T02444                                 

Gene name
fadA2
Definition
(GenBank) acetyl-CoA acyltransferase FadA2
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mli  Mycobacterium liflandii
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MULP_00505 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    MULP_00505 (fadA2)
   00640 Propanoate metabolism
    MULP_00505 (fadA2)
   00650 Butanoate metabolism
    MULP_00505 (fadA2)
  Lipid metabolism
   00071 Fatty acid degradation
    MULP_00505 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    MULP_00505 (fadA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MULP_00505 (fadA2)
   00310 Lysine degradation
    MULP_00505 (fadA2)
   00380 Tryptophan metabolism
    MULP_00505 (fadA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MULP_00505 (fadA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MULP_00505 (fadA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MULP_00505 (fadA2)
Enzymes [BR:mli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MULP_00505 (fadA2)
Exosome [BR:mli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MULP_00505 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
556162..557487
Genome map
AA seq 441 aa AA seqDB search
MAPAAEKNAQTKRRVAVLGGNRIPFARSDGAYAEASNQDMFTAALAGLVDRFDLRGQRLG
AVVGGAVLKHSRDFNLMRECVLGSELSPYTAACDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGEDLRRTLLRLRRAKSNVHRLRLVGGLPANLGVEIPANSEPRTG
LSMGDHAAITAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVTPFLGLYRDDNLRPN
SSVEKLASLRPVFGVMAGDATMTAGNSTPLTDGASVALLSSEQWAQEHSLSPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLTLQDFDFYEIHEAFASVVLAHLQAWESEEY
CKQRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAERKGSAQP
VRALISICAAGGQGVAAILEA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctgagaagaatgcccagaccaagcggcgagtcgccgtcctggggggt
aatcgaatccccttcgcccggtccgacggcgcttacgccgaagcgtccaaccaggacatg
ttcaccgcggcgctggccgggctggtggaccggtttgacctgcgcgggcaacggctgggc
gccgtcgtcggtggtgccgtgctcaagcacagccgcgacttcaacctgatgcgcgaatgc
gtgttgggatcagagctgtccccgtacaccgcggcgtgtgacctgcagcaagcctgcggg
accggcctgcaggccgcgatcgctgccgctgacgggatcgccgccggacgttatgaggtt
gcggcggccggcggcgtggacaccacctcggacccgccgatcgggctgggtgaggacctg
cgccgcaccctgctgcggctgcgtcgggccaagtccaacgtgcacaggctgcgcctggtg
ggtgggctgccggccaatctgggagtcgagatcccggccaacagcgagccccggaccggg
ctgtcgatgggcgatcacgccgccatcaccgccaagcagatgggtatcaaacgcgttgac
caggacgaactggctgcggccagtcatcgcaacatggccgacgcctacgaccgcggattc
ttcgacgacctggtgacgccattcttggggctgtaccgtgacgacaacctgcgccccaac
tcgagcgtcgagaagctcgcctcgctgcgcccggtattcggcgtcatggccggcgacgcc
accatgacggcgggcaactcgactccgctgaccgacggtgcctcggttgcgttgctgtcc
agcgagcaatgggcgcaggagcattcgttgtcgccgctggcctacctcgtggacgccgag
acggccgcggtggactacgtcaacggcaacgacggtctgttgatggcgcccacctacgcc
gtgccgcgattgctggcccgcaacgggttgacgctgcaagatttcgacttctacgagatc
cacgaggccttcgcctcggtggtgttggcgcacctgcaggcatgggagtccgaggagtac
tgcaagcagcgcctgggactggacgccgcgcttggttcgatcgaccggtccaagctcaac
gtcaacggttcatcgttggccgccgggcacccgttcgcggcgactggtggacggatactg
gcgcagaccgccaagcagctggccgagaagaaggccgagcgcaagggatcggcccagccc
gtgcgcgcgctgatctcgatctgcgctgccggcggtcagggcgtggccgcaatcctggag
gcctga

DBGET integrated database retrieval system