KEGG   Mycobacterium liflandii: MULP_00523Help
Entry
MULP_00523        CDS       T02444                                 

Definition
transcriptional regulatory protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mli  Mycobacterium liflandii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mli00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(573863..575014)
Genome map
AA seq 383 aa AA seqDB search
MAQQKSEPLRGYRIAVTSSRRAEELCALLRRHGADVCSAPAINMIALPEDDELQGNTEAL
IANPPDILVAHTGIGFRGWVAAAEGWGLAGELVDALSVGRTISRGPKATSELRAAGLREE
WSPESESSQEVLEYLLESGVAGQRIAIQLHGAADGWDPFPEFVGGLRAAGAEVVPIRVYR
WKPTPLGGAFDQLVTEIARRQFDAVSFTSAPAAAAVLERGRKLDIEEELLEALRNDVHAM
CVGPVTSRPLIRKGVPTSSPERMRLGALARHIAEELPLLGSCTVNAAGHVVDIRGTCVLV
DGSIKTLSGSGMAILRALTKRPGDVVARSELLNVLPGNGDDTHAVDTAVLRLRTALGDKN
IIATVVKRGYRLALDTQDDTACT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaaaaatctgagccactgcggggctaccggattgcggtgacgtcttctcgc
cgggccgaggagttgtgcgcacttctgcgccgccacggtgccgacgtctgcagtgcccct
gcgatcaacatgatcgcgctgcccgaagacgacgaactccagggcaatacggaggcgttg
atcgccaacccacccgacatcctggtggcccacaccggtatcggtttccggggctgggta
gccgcggccgaggggtgggggctggccggcgaactcgttgatgcgttgtcggtaggccgg
accatatcgcgcggaccgaaggcgaccagcgagctacgcgcggcgggcttgcgcgaagaa
tggtcgccagaatcggaatcctcgcaagaagttctggaatacctgcttgaatccggggtc
gccggtcagcggatcgccattcagctacacggcgcggccgatggctgggatcccttcccc
gagtttgtcggcggcctccgcgcggcgggggccgaggtggtgcccattcgggtgtaccgc
tggaagccaacgccattgggcggcgcgttcgaccaattggtcaccgagatcgcccggcga
cagttcgacgcggtgagtttcacctctgcgcccgccgcggccgcggtgctcgagcgtggc
cgcaagctggatatcgaagaggaactgctggaggcgctgcgcaacgacgtacacgcgatg
tgcgtcggccccgtcacctctcgccccttgatccgcaagggggtgcccacctcatcgccg
gagcgaatgcggctgggcgccttggcccgtcatatcgccgaggaacttccgctacttggc
tcctgcaccgtgaacgccgcaggccacgtcgtcgacatccgcggaacctgcgtgctcgtc
gatggctccatcaagacactgtcggggtcgggcatggcgatattgcgcgccttgaccaag
cgccccggagacgtcgtcgcccgcagcgagctgctgaatgtgcttcccggaaacggcgac
gacactcacgcggtagacaccgccgtattgcggctgcgcacggcgctgggcgacaaaaac
atcatcgcgacggtggtcaagcgtggttaccggctggcgctcgacacccaggacgacacc
gcatgcacctga

DBGET integrated database retrieval system