KEGG   Mycobacterium liflandii: MULP_00523Help
Entry
MULP_00523        CDS       T02444                                 

Definition
transcriptional regulatory protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mli  Mycobacterium liflandii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MULP_00523
Enzymes [BR:mli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MULP_00523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(573863..575014)
Genome map
AA seq 383 aa AA seqDB search
MAQQKSEPLRGYRIAVTSSRRAEELCALLRRHGADVCSAPAINMIALPEDDELQGNTEAL
IANPPDILVAHTGIGFRGWVAAAEGWGLAGELVDALSVGRTISRGPKATSELRAAGLREE
WSPESESSQEVLEYLLESGVAGQRIAIQLHGAADGWDPFPEFVGGLRAAGAEVVPIRVYR
WKPTPLGGAFDQLVTEIARRQFDAVSFTSAPAAAAVLERGRKLDIEEELLEALRNDVHAM
CVGPVTSRPLIRKGVPTSSPERMRLGALARHIAEELPLLGSCTVNAAGHVVDIRGTCVLV
DGSIKTLSGSGMAILRALTKRPGDVVARSELLNVLPGNGDDTHAVDTAVLRLRTALGDKN
IIATVVKRGYRLALDTQDDTACT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaaaaatctgagccactgcggggctaccggattgcggtgacgtcttctcgc
cgggccgaggagttgtgcgcacttctgcgccgccacggtgccgacgtctgcagtgcccct
gcgatcaacatgatcgcgctgcccgaagacgacgaactccagggcaatacggaggcgttg
atcgccaacccacccgacatcctggtggcccacaccggtatcggtttccggggctgggta
gccgcggccgaggggtgggggctggccggcgaactcgttgatgcgttgtcggtaggccgg
accatatcgcgcggaccgaaggcgaccagcgagctacgcgcggcgggcttgcgcgaagaa
tggtcgccagaatcggaatcctcgcaagaagttctggaatacctgcttgaatccggggtc
gccggtcagcggatcgccattcagctacacggcgcggccgatggctgggatcccttcccc
gagtttgtcggcggcctccgcgcggcgggggccgaggtggtgcccattcgggtgtaccgc
tggaagccaacgccattgggcggcgcgttcgaccaattggtcaccgagatcgcccggcga
cagttcgacgcggtgagtttcacctctgcgcccgccgcggccgcggtgctcgagcgtggc
cgcaagctggatatcgaagaggaactgctggaggcgctgcgcaacgacgtacacgcgatg
tgcgtcggccccgtcacctctcgccccttgatccgcaagggggtgcccacctcatcgccg
gagcgaatgcggctgggcgccttggcccgtcatatcgccgaggaacttccgctacttggc
tcctgcaccgtgaacgccgcaggccacgtcgtcgacatccgcggaacctgcgtgctcgtc
gatggctccatcaagacactgtcggggtcgggcatggcgatattgcgcgccttgaccaag
cgccccggagacgtcgtcgcccgcagcgagctgctgaatgtgcttcccggaaacggcgac
gacactcacgcggtagacaccgccgtattgcggctgcgcacggcgctgggcgacaaaaac
atcatcgcgacggtggtcaagcgtggttaccggctggcgctcgacacccaggacgacacc
gcatgcacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system