KEGG   Mycobacterium liflandii: MULP_00998Help
Entry
MULP_00998        CDS       T02444                                 

Gene name
fucA_1
Definition
class II aldolase/adducin domain protein (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mli  Mycobacterium liflandii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mli00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087635..1088420
Genome map
AA seq 261 aa AA seqDB search
MTSTMHDTKSDLMQRAQDNLTRHVGESEWTTQEKLALTCRSLFDAGHDSGLAGQITARAE
RPGTYYTQRLGLGFDEITAGNLLVVDEDLNVLEGDGMANPANRFHSWIYRARPDVNCIVH
THPFHVAALSMLEVPLVVSQMDIAPLYDDCAFLPDWPGVPVGNEEGEIISSALGDKKAIL
LAHHGHVVAGASIEEACSLAMLIERGAKLQLAAMAAGTIAPLPDRLAREAHDWTLTPKRS
QANFAYYARRALIHHPDALTH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcactatgcacgacacgaagagcgatttgatgcagcgcgctcaggacaatttg
acacgccacgtcggcgagtccgagtggactactcaggagaaactggcgctgacgtgccgg
tccttgtttgacgccggtcacgattcgggcctggccgggcagatcaccgcgcgcgccgaa
cggccgggcacctactacacccagcgcctgggcctggggttcgatgagatcaccgcaggc
aacctgcttgtcgtggatgaagacctcaacgtcctcgagggggacggaatggccaatcct
gccaatcggttccactcctggatttatcgtgcccgacccgatgtcaactgcatcgtgcat
acccaccccttccacgtcgcggcgctgtccatgctcgaggtgccgttggtggtgtcgcag
atggacattgcgccgctgtatgacgactgcgcatttttaccggactggccgggtgtgccc
gtgggcaacgaagaaggcgagatcatttcaagcgccttgggcgacaagaaggccatcttg
ttagcacatcacggccatgtggtggcaggtgccagtatcgaggaagcctgctcgctggcc
atgctgatcgagcggggcgccaagctgcagctggccgccatggccgccggcaccatcgcc
ccgctgcccgatcggctggcacgcgaagcgcatgactggacgctgacccccaaaaggagc
caggccaacttcgcctactacgcacggcgagctctgattcaccacccagacgcgctcacc
cactga

DBGET integrated database retrieval system