KEGG   Mycobacterium liflandii: MULP_01281Help
Entry
MULP_01281        CDS       T02444                                 

Gene name
choD
Definition
cholesterol oxidase precursor ChoD (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mli  Mycobacterium liflandii
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MULP_01281 (choD)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MULP_01281 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1369768..1371540
Genome map
AA seq 590 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFSDAEFAKTSWDLRKFLWAPKL
GCYGIQRIHPLKNVMILAGAGVGGGSLNYANTLYVPPDPFFNDQQWKHITDWRDELMPHY
QQAQRMLGVVKNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGTKTPGKTVPDPY
FGGAGPARTGCTECGECMTGCRHGAKNTLVKNYLGLAESAGAEVIPMTTVKGFEQRPDGL
WEVRTVRTGSWARRDRRTFTASYLILAAGTWGTQHLLFKMRDKGKLPRLSKRLGVLTRTN
SESIVGAATLKVNPDLDLTHGVAITSSIHPTPDTHVEPVRYGKGSNAMGLLQTLMTDGSG
PSGTDVARWRQLLDQAGESPRRVFRLINPRQWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGHGEPNPTWIPVGNQVTRRIAEKIDGVAGGTWGELFNIPLTAHFLGGAVIGDN
PDSGVIDPYHRVYGYPTMFVVDGAAISANLGVNPSLSITAQAERAASLWPNKGQNDERPL
QGDGYSRLSPVQPEHPVVPPTRPARCAGCPSIRSAGSAARADAGRAQAGG
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtcttgattatcggttcgggtttcgggggcagtgtgagtgcg
ctgcgcctgacggagaaaggctaccgggtcggcgtgctggaggccggccggcgcttcagt
gatgccgaattcgccaagacatcctgggatctgcgcaaattcctgtgggcgcccaagctg
ggttgctacggcatccagcgcatccacccgctgaaaaacgtgatgatcctggccggcgcg
ggggtgggcggcggatcgctgaactatgccaacacgctctacgttccgccggacccattc
ttcaacgaccagcagtggaaacacatcaccgactggcgcgacgagctgatgccgcactac
cagcaggcgcagcggatgctgggcgtggtgaaaaacccgacgttcaccgacgcggaccgc
atcgtcaaggaagtcgccgacgagatgggattcggtgacacctgggtgcccaccccggtc
ggggtgttcttcggtcccgacggcaccaagacgccgggcaagacggtgcccgacccctac
ttcggcggtgccggccccgcgcgaaccggctgcaccgaatgcggcgagtgcatgaccggc
tgtcgccatggcgccaagaacaccctggtaaagaactaccttggtctggcggaatcggct
ggtgccgaggtgattccgatgaccacggtgaagggcttcgagcagcggccggacgggttg
tgggaggttcggacggttcgcaccggcagttgggcacgacgggaccggcgtaccttcacc
gcctcgtacctgatcttggccgctggtacctgggggacccagcatctgctgttcaagatg
cgcgacaagggcaagttgcccaggctctccaagcggctgggcgtgctgacccgaaccaac
tccgaatccatcgtcggcgccgcgacgttgaaggtgaatccggacctggacctgacccac
ggggtggcgatcacgtcgtcgattcacccgacgccggatacccacgtcgagccggtccgc
tacggcaagggctccaacgcgatggggttgttgcagacgctgatgaccgacggttccggt
cccagcggcaccgacgtggcgcgttggcgccagctgctcgaccaggccggggagagtccg
cgcagggtgttccggctgatcaacccccggcagtggagcgagcgcacggtgatcgcgctg
gtcatgcagcacctggacaactcgatcaccacgttcaccaagcgcggcaagttgggcatc
cgctggtattccagcaagcaggggcacggcgaaccgaacccgacctggatcccggtcggc
aaccaggtgacccgccgcattgccgagaagatcgacggggtggccggcggtacctggggt
gagttgttcaacatcccgctgaccgcgcacttcctgggtggtgcggtgatcggcgacaac
cccgacagcggggtcatcgacccgtatcaccgcgtctacggctacccgaccatgttcgtg
gtcgacggtgccgcgatctcggcgaaccttggtgtcaacccctcgctgtccatcaccgca
caagccgagcgtgccgcctcgctctggcccaacaagggccaaaacgatgagcggccgctg
cagggcgacggctacagtcggctgtccccggttcagccggaacacccggtggtgccgccg
acgcgcccggcgcgctgcgctggctgcccatcgatccggtcagccgggtcagcagcgcgg
gctgacgccgggcgcgcgcaggccggcggctag

DBGET integrated database retrieval system