KEGG   Mycobacterium liflandii: MULP_01360Help
Entry
MULP_01360        CDS       T02444                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mli  Mycobacterium liflandii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MULP_01360 (deoA)
Enzymes [BR:mli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MULP_01360 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1462545..1463846
Genome map
AA seq 433 aa AA seqDB search
MTDFEFDAPTVIRIKRDGGRLSDAAIDWVIDAYTEGRVAPEQMSALLMAIVLQGMDRGET
ARWTSAMLASGPRLDFSDLRAGGAPLVTVDKHSTGGVGDKITLPLVPVVVACGGTVPQAS
GRGLGHTGGTLDKLESISGFTATLSNQQVREQLCDVGTAIFAAGELAPADAKLYALRDIT
GTVESLPLIASSIMSKKLAEGAGALVLDVKVGSGAFLKSETQSRELAHTMVELGAAHGVP
TRALLTDMNCPLGSTVGNALEVAEALEVLDGGGPPDVVELTVRLAAEMLDLVGIDGRDPA
ETLRDGSAMDRFRRLIAAQGGELAKPLPIGAHSETVRAGRGGTMGDIDAMAVGLAAWRLG
AGRSRPGARVQHGAGIRIHRRPGEPVAAGEPLFTLYTDTPERFGAAVAELAAGFSVADSA
PTTRPLIIDRISR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgacttcgagttcgatgcaccgacggtgatccgcatcaagcgtgacggcggtcgg
ctgtccgatgccgctatcgactgggtgatcgacgcctacaccgagggccgggtcgcgccc
gaacagatgtcggcgctgctgatggcgattgtcttgcagggcatggaccgaggtgagacc
gcccggtggacatcggcgatgctggcgtcgggcccgcggttggacttctccgatctgcgc
gcgggcggtgcgccgttggtgaccgtggacaagcactccaccggcggggtgggggacaag
atcacgctgccgctggtgcctgtcgtcgtcgcctgtgggggcactgtcccgcaggcgtcg
ggtcgtgggctcggccacaccggcggcaccctggacaaactggaatccatcagtggattc
accgcgacgctgtccaaccagcaggtgcgtgaacagctttgcgatgtcggcaccgcgatc
ttcgccgctggtgagctggcgcccgccgatgccaagctgtacgcgctgcgcgacatcacc
ggcaccgtggaatcgctgccgttgattgccagctcgatcatgagcaagaagctggccgag
ggggcgggcgcgctggtgctggacgtgaaggtcggctcgggagcgtttctgaaatccgaa
acccaatcacgtgaattggcacacaccatggtcgagctgggcgcggcacacggcgtgccc
acccgagcgctgctgaccgacatgaactgtccgttgggctcgaccgtcggcaatgcgctc
gaggtggccgaggcgctggaggtgctcgacggcggtgggccgcccgacgtggtggaactg
acggtgcggttggcagccgagatgctcgacctggttgggatcgatggccgcgacccggcc
gagacgctgcgcgacggctccgcgatggaccggtttcgccggctgatcgcggcccagggg
ggagagttggccaaaccgttgccgattggtgcgcattcggaaaccgtccgggccggccgc
ggcggcacaatgggcgacatcgatgcgatggcggtggggttggcggcatggcggctcggc
gcgggcaggtcccgccccggcgcacgggtccagcacggcgctggcattcggatccatcgg
cgaccgggggagccggtggcggccggtgagcccttgttcacgctctataccgacaccccc
gagcggttcggcgccgcggtagccgagctggccgccggcttcagcgtcgctgacagcgcg
ccgaccactcggcctctcatcattgatcggatcagccgatga

DBGET integrated database retrieval system