KEGG   Mycobacterium liflandii: MULP_01623Help
Entry
MULP_01623        CDS       T02444                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase, MhpF (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mli  Mycobacterium liflandii
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MULP_01623 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MULP_01623 (mhpF)
   00650 Butanoate metabolism
    MULP_01623 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MULP_01623 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MULP_01623 (mhpF)
   00622 Xylene degradation
    MULP_01623 (mhpF)
   00621 Dioxin degradation
    MULP_01623 (mhpF)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MULP_01623 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1745222..1746232
Genome map
AA seq 336 aa AA seqDB search
MSLGAADVGAGAGPPGQHAGAVDNWPVAIISSGVVGTDLMSRIGNGDGRLRVSAMVGTNP
HCDGLARAAAAGISTSPGGVDGLLSMPEFANIRLVFDTTNPGAHQSNWARLADTGVRMLD
LTASAIGPCCVPAVNLDAQLDAPNLSMATCSAQAAVPIVAAVRRHGVVRYAEVVSAIASQ
ALGPAERVTLDEFAELTTTAVQELGGARRAKTLTIVNPADPPMPMRTTVFCLVDQADEVA
RIEADVLAVVDGVQALLPGYRLKHRVQFERLGSGNTLYIPGTGEFGGTRITVLLEITAAG
GYLPACAGNVAIVTSAAKATAEAIVERHAQTLKAKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgggcgccgccgacgtcggtgctggcgcgggtccgcccggccagcatgcgggc
gcagtggacaactggccggtggcgatcatcagctccggtgttgtcggcaccgatctgatg
agcaggatcggcaatggcgacggacggctgcgggtgagcgcgatggttggcaccaacccg
cactgtgacggcctggcccgggcggccgccgcagggatctcgaccagcccaggtggggtt
gacgggctgctgagcatgcccgagtttgcgaatatccgcctggttttcgacaccaccaac
cccggcgcacaccagagcaattgggcgcggctggccgataccggcgtacggatgctcgac
ctcaccgcgtccgcgatcggcccatgctgcgtgccggcagtcaatctcgatgcccagctc
gacgcgccgaacctgagcatggcgacctgcagcgcacaggcggcggtgcccatcgtcgcc
gcggtgcgccggcacggggtggtgcgctatgccgaagttgtttctgccatcgcctcgcag
gccctggggccggctgagcgggtgaccctcgatgaattcgccgaactgaccacgaccgcg
gtccaagagctcggcggcgcgcgccgggccaagacgctcacgatcgtcaaccccgccgat
ccaccgatgccgatgcgcaccaccgtcttctgcctggttgaccaagctgacgaggtggct
cggatcgaggcggacgtactggccgtggtcgacggagtccaagccttgctgcccggctac
cggctcaagcatcgcgtgcaattcgagcggttgggcagcggcaacacgctctacattccg
gggacgggggagttcggtggcactcggatcaccgttctgcttgagatcaccgctgccggg
gggtacctgccagcctgcgccggaaacgtcgcgatcgtgacgtcggcggccaaggccacc
gccgaggcgatcgtcgaacgccacgctcaaacgctaaaggcgaaaatatga

DBGET integrated database retrieval system