KEGG   Mycobacterium liflandii: MULP_01835Help
Entry
MULP_01835        CDS       T02444                                 

Definition
transferase (EC:2.-.-.-)
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mli  Mycobacterium liflandii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MULP_01835
Enzymes [BR:mli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MULP_01835
Glycosyltransferases [BR:mli01003]
 Polysaccharide
  Storage polysaccharide
   MULP_01835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1953897..1955276)
Genome map
AA seq 459 aa AA seqDB search
MACSGLWTHEGCPSERAGDRRACAAVQRHAAAADILCTFVEGATFMKILMVSWEYPPVVI
GGLGRHVHHLATALVAAGHEVVVLSRRPSGTDPSTHPPSDLISEGVRVIAAAQDPHEFSF
GSDMMAWTLAMGHAMVRAGLTLSGPGAEQPWQPDIVHAHDWLVAHPAIALADYYDVPMVS
TIHATEAGRHSGWVSGDLSRQVHAVESWLVRESDSLITCSGSMSDEITELFGPGLAETAV
IRNGIDAARWPFAVRKPRTGPPELLYVGRLEYEKGVHNAIAALPRIRRAHPGTTLTIAGE
GTQQDWLVEQARKHRVLKATKFLGHLEHAELLTLLHRADAAVFPSHYEPFGLVALEAAAA
GTPLVTSNIGGLGEAVIGGVTGVSCPPRDVAALAAAVCGVLDDPAAAQQRARAARERLNS
DFDWQTVAEQTAQVYLAAKRGERQPLPRLPIVEHALPDR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcctgttcggggctctggacgcacgaaggctgcccaagtgagcgcgccggcgaccga
cgagcgtgcgcggctgtacagcgacacgccgctgcggccgacattttgtgcacgttcgtg
gagggggccacgttcatgaagatcctgatggtgtcgtgggagtacccaccggtggtgatc
ggcgggctcggccgccatgtccaccacctcgccaccgcattggtcgcggccggccacgaa
gtcgtggtgctgtcccgccggccctcgggcaccgaccccagcacccacccaccgtctgat
ctgatcagcgagggagtccgggtgatcgcggccgcgcaggatccgcacgaattcagcttc
ggtagcgacatgatggcttggaccctggccatgggtcacgccatggtccgggccggcctt
accctcagcggtcccggcgcggagcaaccctggcaacccgacatcgtgcacgcgcatgac
tggctggtggcacatccggcgattgcgctcgccgactactacgacgtgccaatggtttcc
acgattcatgcgaccgaagccgggcggcattccggttgggtttcgggagatctgagtcgc
caggtgcacgcggtcgaatcctggctggtgcgtgaatccgattcgctgatcacatgttcg
ggatcgatgagcgatgagatcaccgagctgttcggcccagggctggccgaaacggcggtg
attcgcaacggtatcgacgcggcgcgctggccttttgcggtccgtaaaccacgcaccggg
ccaccggaactgctctacgtcggtcggctggagtacgagaagggtgtgcacaatgccatt
gccgcactgccgcggatcaggcgcgcgcacccaggcaccacacttaccatcgccggcgaa
ggcacccaacaggattggctggtcgagcaggcacgcaaacaccgggtgctcaaggccacc
aagttcctgggccacctcgagcacgccgaactgctgaccctgctacatcgggccgacgcc
gcggtgttccccagccactacgagccgttcggactggtcgcgctggaggccgccgcggcc
ggaacaccgttggtgacgtcgaatatcggcgggttgggcgaagcggtgatcggcggggtc
accggggtatcgtgcccaccccgcgacgtggcggcgctggccgccgcggtgtgcggtgtg
ctcgatgatccggccgccgcgcagcaacgtgcccgggccgcgcgggaacggctcaactcc
gacttcgattggcagaccgtggccgagcagaccgcgcaggtgtacctggcggccaagcgc
ggagaacggcagccgctgccccggttgccgatcgtcgagcacgcgctgcctgatcgctag

DBGET integrated database retrieval system