KEGG   Mycobacterium liflandii: MULP_01836Help
Entry
MULP_01836        CDS       T02444                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mli  Mycobacterium liflandii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MULP_01836
Enzymes [BR:mli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MULP_01836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1955233..1956828)
Genome map
AA seq 531 aa AA seqDB search
MTNWDNTNSPDRVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAAYLPLFRVLRTLA
DEGRRGLITLGMTPVVNAQLDDPYCLDGMHHWLANWRLRAAEATSVRSAPASKSAKHLSC
TPEALRDFGTRECAEADQALDDFAAAWRHGASPLLRALIDAGTVELLGGPLAHPFQPLLN
PRLREFALREGLADARLRMAHSPSGIWAPECAYAPGMEHDYAAAAVSHFMVDGPSLHGDT
ALGRPVGDTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVA
SEAKAPYDPQRADRAIDVHVADFVEVVRGRLIAESQRIGRPAHVVAAFDTELFGHWWYEG
PTWLQRVLRALPAAGVRVGTLHDAMANGFVGAPVELPPSSWGSGKDWQVWNGPKVSDLVQ
LNSEVVDTALTTVDKALAQTASLDGPIPRDHVADQILRETLLTVSSDWPFMVSKDSAADY
ARYRAHLHAHATREIAGALASGRRDNAQRLAQGWNRADGLFGALDARRLPK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaattgggacaacaccaattcgccagaccgggtgcccgggttgttcaccctggtg
ctgcacacccatctgccctggcttgcccaccacggccgatggccggtcggcgaggagtgg
ctctaccagtcctggtcggccgcctacctgccgttgttccgggtgctgcgcaccctggcc
gacgaggggcgccgcgggctcatcacgctggggatgactccggtagtcaacgcccaactc
gatgacccctattgcctggacggaatgcatcactggctggccaactggcggctgcgcgcg
gccgaggccaccagcgtccggtctgcgcccgcatcgaagtcggccaaacacctctcctgc
acaccagaggccctacgcgacttcggaacccgcgagtgcgccgaggccgatcaggcgctt
gacgacttcgccgccgcctggcgccatggcgcaagcccgctgctgcgcgccctgatcgac
gccggcacggtcgagttgctcggcggcccactggcccacccgttccagccgttgctgaat
ccgcggctgcgggagttcgcgctgcgcgaaggtttggccgacgcacggctgcggatggcg
cacagcccatcggggatctgggcacccgaatgcgcatacgcccccggcatggagcacgac
tacgcggccgccgcggtcagccatttcatggtggacggtccatccctgcacggcgacacc
gcactgggccgaccggtcggcgacaccgacgtggtcgcgttcgggcgtgatctgcaggtc
agctaccgggtgtggtcaccgaaatccggctaccccgggcatgccgcataccgcgatttc
cacacctacgatcacctgaccggcctcaaaccggcccgcgtcaccggccgcaatgtggca
tcggaggccaaagccccctacgacccgcagcgcgccgaccgcgcgatcgacgtccacgtc
gccgacttcgtcgaagtggtgcgcggccggctgattgccgagtcacagcgcatcggccgg
cccgcgcacgtggtcgccgcgttcgacaccgagttgttcggccattggtggtacgagggg
ccgacctggttgcagcgggtgctgcgcgccctgcctgccgccggcgtgcgggtgggaacg
ctgcacgatgccatggccaacggattcgtgggcgctccggtcgaattgccccccagctct
tggggttccggcaaggactggcaagtctggaacggccccaaggtgtccgatctggtccag
ctcaactccgaagtggtcgacaccgcactgaccaccgtcgataaggcgctggcccagacc
gcgtccctggatggcccgatcccccgcgatcacgtcgccgatcagatcctgcgtgagacg
ctgctgaccgtctcgagcgactggccgttcatggtgagcaaggactccgccgccgactat
gcgcgctatcgcgcgcacttgcatgcgcacgccacccgagagatcgccggggcgctggcg
tcgggccggcgcgacaacgcccagcgactggcccaaggctggaaccgcgccgatggcctg
ttcggggctctggacgcacgaaggctgcccaagtga

DBGET integrated database retrieval system