KEGG   Mycobacterium liflandii: MULP_02052Help
Entry
MULP_02052        CDS       T02444                                 

Definition
magnesium chelatase (EC:4.99.1.-)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mli  Mycobacterium liflandii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MULP_02052
Enzymes [BR:mli01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MULP_02052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2225005..2226855
Genome map
AA seq 616 aa AA seqDB search
MKAYPFSAIVGHDQMRLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAALLSAATGSSG
PGLVEMPLGATEDRVVGSLDLQRVLRDGEHAFAPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVDV
RVEVIRQRMAFEADPDAFCERYVGPDAELARRIAEARDIVDTVVLPDHELRRIAALCAAF
DVDGMRADLVLARTATAHAAWRGAPAVEEQDVRVAAELALPHRRRRDPFDDHGIDRDQLD
EALARAGAESQGSPEPEPDPPGGGQSAGQDCPPQQQNSNSRPQQAPKPSAGPSKVFRTRA
LVVPGVGEGAPGRRSRARNGSGSVVAAADGSDSNSGARGLHLFATLLSAAENATGSGPLR
PQGADIRRAVREGREGNLVIFVVDASGSMAARDRMAAVSGATMSLLRDAYQRRDKVAVIT
FRQHEAKILLSPTSSAHIASRRLARFDTGGKTPLAEGLLAARELVIREKVRDRARRPLVV
VLTDGRATAGPDPLGRSRIAAARLVAEGATAVVVDCETSYVRLGLAQQLARHLGAPAVRL
EQLHADYLAQAIRSVA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctatccattcagcgcgatcgttggacacgaccagatgcgactggcgttgctg
ttgtgcgccgttcgtccggagataggcggcgtgctcattcgcggcgagaagggcaccgcg
aaatcaacagccgtgcgcgggctcgccgcgctactgtccgccgctaccggcagttccggt
cccgggctggtcgaaatgccgctgggagccaccgaggaccgggtggtcggctcgctggac
ctgcagcgcgtcttgcgcgatggcgaacacgccttcgcgccgggactgctggcccgcgcc
cacgggggagtgctctacgtcgacgaagtgaacttgctgcacgatcatctggtcgacatc
ttgctcgacgccgccgcgatggggcgggtgcacgtcgaacgggacggcatctcacattcg
cacgaggcccgcttcgtcctgatcggcacgatgaatcccgaagaaggcgaactgcgtcca
caactgctggaccggttcgggctgaccgtcgacgtgcacgcgtcccgcgatgtggacgtc
cgcgtggaagtcattcgccagcggatggcttttgaagccgacccggacgccttctgtgaa
cgctatgtcggccccgacgccgagctggcccgccgtatcgccgaggcgcgggacatcgtc
gacacggtcgtgttgcccgaccacgaattgcgccggatcgccgcgttgtgcgcggcgttc
gacgtcgatggcatgcgagcggatctggtgctggcccgaacggccaccgctcatgcggcg
tggcgcggcgcaccggccgtcgaagaacaagacgtgcgggtcgccgcggaactggcattg
ccccatcgccgtcgtcgggacccattcgacgatcacggtattgaccgcgaccagctcgac
gaggcactggcacgggccggagcggagtcgcagggttcgcccgagccggagcctgacccg
ccgggtggaggccagtcagccggccaggattgccctccccaacaacagaactcgaactcc
aggccccagcaggcgcccaagcccagcgccgggccgtccaaggtgttccgcacccgcgcg
ctggttgtgcccggggtcggcgaaggtgcgcccgggcggcgctcgcgggcgcgcaacggc
tccggcagcgtggtagcggccgccgacggtagtgacagcaattccggcgcccgtgggttg
cacctgttcgccaccttgctctcggccgccgaaaacgccaccggatcggggccgctgcgc
ccgcagggcgccgacatccgccgggcggtgcgcgaggggcgtgagggcaacctggtgatc
ttcgtcgtggacgcttcgggatcgatggctgcccgggatcggatggcggcggtcagcggc
gcgaccatgtcgctgctgcgcgatgcctaccagcgccgggacaaggtcgcggtgatcacg
ttccgccagcatgaagccaagatcctgctgtcacccacctcgtcggcgcacatcgccagc
cggcggctggcccggttcgacaccggcggcaagactccgctggccgagggtctgctggcc
gcgcgcgagctggtgatccgggagaaagtacgcgaccgtgcccgccgcccgctggtggtg
gtgctcaccgatggacgggccaccgccgggccggacccgttgggccgcagccgaatcgcc
gccgctcggcttgtcgccgaaggcgccaccgcggtggttgtggactgcgagacgtcgtat
gtgcggctcggactggcccagcaactcgcccgccatctcggcgcgccggcggtgcggctc
gaacagttgcacgccgactacttggcgcaagccatccgcagcgtggcctga

DBGET integrated database retrieval system