KEGG   Mycobacterium liflandii: MULP_02123Help
Entry
MULP_02123        CDS       T02444                                 

Gene name
dfrA
Definition
dihydrofolate reductase DfrA (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mli  Mycobacterium liflandii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mli00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mli00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2299390..2299887
Genome map
AA seq 165 aa AA seqDB search
MTSVGLIWAQSTSGVIGRDGGIPWRLPEDLAHFKRLTMGHTVVMGRRTWDSLPAAHRPLP
GRRNVVVTRQTGLVAHGAQVVGSLEQALCPAEPDAETWVIGGAQIYALALPLANRCEVTE
VDVDLPPEDEDAVAPVLDQTWAGTSGEWLVSRSGLRYRMHSYRRL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggtgggcctgatctgggctcagtccacctccggggtcatcggccgtgatggc
ggcatcccgtggcgactgcccgaggatctcgcgcacttcaaacggctcaccatggggcac
accgtggtgatgggccgccggacctgggactccctgcccgccgcccaccggccactgcca
ggccggcgaaatgtcgtagtgacccgccagactggtctggtggcgcacggagcgcaggtg
gtgggttccctcgagcaggcgttgtgtccggccgagccggatgccgagacatgggtgatc
ggtggtgcccagatctacgcgctggcgctgcccctggcgaacaggtgtgaagtcaccgag
gtcgacgtcgacttaccgcccgaggacgaggacgccgtggcccccgtgctcgaccagacc
tgggctggcacctcgggggagtggctggtcagccgctcgggactgcgataccggatgcac
agctaccgccgactatga

DBGET integrated database retrieval system