KEGG   Mycobacterium liflandii: MULP_02123Help
Entry
MULP_02123        CDS       T02444                                 

Gene name
dfrA
Definition
dihydrofolate reductase DfrA (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mli  Mycobacterium liflandii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MULP_02123 (dfrA)
   00670 One carbon pool by folate
    MULP_02123 (dfrA)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MULP_02123 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2299390..2299887
Genome map
AA seq 165 aa AA seqDB search
MTSVGLIWAQSTSGVIGRDGGIPWRLPEDLAHFKRLTMGHTVVMGRRTWDSLPAAHRPLP
GRRNVVVTRQTGLVAHGAQVVGSLEQALCPAEPDAETWVIGGAQIYALALPLANRCEVTE
VDVDLPPEDEDAVAPVLDQTWAGTSGEWLVSRSGLRYRMHSYRRL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggtgggcctgatctgggctcagtccacctccggggtcatcggccgtgatggc
ggcatcccgtggcgactgcccgaggatctcgcgcacttcaaacggctcaccatggggcac
accgtggtgatgggccgccggacctgggactccctgcccgccgcccaccggccactgcca
ggccggcgaaatgtcgtagtgacccgccagactggtctggtggcgcacggagcgcaggtg
gtgggttccctcgagcaggcgttgtgtccggccgagccggatgccgagacatgggtgatc
ggtggtgcccagatctacgcgctggcgctgcccctggcgaacaggtgtgaagtcaccgag
gtcgacgtcgacttaccgcccgaggacgaggacgccgtggcccccgtgctcgaccagacc
tgggctggcacctcgggggagtggctggtcagccgctcgggactgcgataccggatgcac
agctaccgccgactatga

  All links  
No link information was found.   
DBGET integrated database retrieval system