KEGG   Mycobacterium liflandii: MULP_02213Help
Entry
MULP_02213        CDS       T02444                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase HemY (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mli  Mycobacterium liflandii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MULP_02213 (hemY)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MULP_02213 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2386790..2388157
Genome map
AA seq 455 aa AA seqDB search
MTPGSYCVVGGGISGLTAAFRLRLAVGEDALITLLDPSDRLGGILRTERVGGQPMDLGAE
AFVVRRPEMPALLAELGLSGLQRSTTGARPLIYSCQELHPLPTGTVMGIPASARSLAGLV
DDATIAQIEAEPDRPLHWRPGGDPAVAELVAERFGEQTVTRSVDPLLCGVYAGSAATIGV
RAAIPAVAAELDRGAPSLTEAVRQSLPPASAGPVFGALTGGYQVLVEELVARSGVQWVQA
AVSKIEPGWALHDDAGRRWHADAVILAIPAPRLVRILDGVDGVDPRSVAAASRVRSASSA
VVALAVPADTPFPQCSGVLVANGEPLRAKAITLSSRKWGIQGDVQQLRISFGRFGDDLAE
RVSDHQLLSWARDDLATVFGVTVDPVDSRVQRWIEAMPQYGPGHGVLVAQVRAGLPPTLA
VAGSYLDGIGVPACVGAASRAVDGVVGALNPQVAR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgggctcgtattgtgttgtgggcggtggaatctcgggcctgaccgcggccttc
cggttgcggctggcggtcggtgaagacgccttgatcaccctgttggaccccagcgatcgg
ctgggcggaatcttgcgcaccgagcgggtcggcggacagccgatggatctgggtgccgaa
gcgttcgtggtgcgccgtccggagatgcccgccctgctcgccgaactcggtctgtccggg
ctgcagcgctccaccacgggcgcccggccgctgatctacagctgccaagagctgcacccg
ctgccaacgggcaccgtgatggggatcccggcttcggcgcgctcgcttgccggcctggtt
gacgacgccacgattgcccagatcgaggccgaaccggaccggccgctgcactggcgcccg
ggcggcgatcccgcggtggccgaactggtggccgagcggttcggcgagcagaccgtgacc
aggtcggtcgatccgctgctgtgcggcgtctatgcgggctcggccgccacgatcggtgtg
cgcgcggccatcccggcggtggcggcggagctggaccgcggcgcacccagcctgaccgag
gcggttcggcagagcttgccaccggccagtgccggtccggtgttcggtgccttgacgggc
ggctatcaggtgctggtcgaggagctggtcgcacgcagtggggtgcagtgggtgcaggcc
gcggtcagcaagatcgaacccggttgggcactgcacgacgatgccggccggcgctggcac
gccgacgccgtcatcctggccatcccggccccgcgcctggtgcggatcctcgacggtgtc
gacggggtggatccgcgcagcgtcgcggccgcgagccgggtgcgcagtgcctcctcggct
gtggtggcgctggcggtgccggcagatacccccttcccgcagtgttccggggtgctggtg
gccaacggtgagccgttgcgggccaaggcaatcacgttgtcgtcgcggaaatggggtatt
cagggcgacgtccagcagctgcggatttcgttcgggcggttcggcgacgacctggccgag
cgcgtgtccgaccatcagctgctttcgtgggcgcgcgacgacctggccacggtgttcggt
gtgacggtggatcccgtcgattcacgtgtgcagcggtggatcgaggcgatgccgcaatac
ggtcccggtcacggggtgctggtcgcgcaagtgcgggccgggctgcccccgacattggcc
gtggccggcagctatctggacggaatcggggtgccggcctgtgtcggggcggcaagccgc
gcggtggacggcgtcgttggggcgctcaacccgcaagtggcacgatag

DBGET integrated database retrieval system