KEGG   Mycobacterium liflandii: MULP_02275Help
Entry
MULP_02275        CDS       T02444                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mli  Mycobacterium liflandii
Brite
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MULP_02275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2446319..2447110)
Genome map
AA seq 263 aa AA seqDB search
MNWYTGNTTYDTVLTIALAVAALVIIGGLFMQSPYGRFGATAGGVNLNPKLGWWLMEIPA
TVVFAIFYLTGPQRFDAAPLVLAAIWLLHYGNRGWFFPLSIRQVPGKRSSFNISVLAAGM
VITSMHGYLNGAFFSHDYRHQYGTKWLTDPRFLLGTLVYLAGFALLVWSESIVRNLRDKK
NPGATEYQIPYGGGFRFVTSPAYLGELIAWAGFALLTWSLAGVAIFAITAGNLVPRAFAT
QKWYREKFPDYPAERKALIPGVI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgaactggtacaccggcaacacgacctatgacaccgtcttgacgatcgccctggccgtc
gcagcgttggtcatcatcggcggcttgtttatgcagagtccctatggtcgcttcggcgcc
accgcgggcggggtgaatctgaacccgaagctgggctggtggctgatggagatcccggca
accgtggtgttcgccatcttctatctcaccggcccacagcgattcgatgccgcgccgctg
gtgcttgcggccatctggctgctgcactacggcaaccggggctggttcttccccctgtcg
atcaggcaggtgccgggaaagcgcagcagcttcaacatctcggtgctcgcggccggaatg
gtgatcacctcgatgcacggatatctcaacggggcgttcttcagccacgactaccggcat
cagtacggcaccaagtggctgaccgatccgcggtttctgctcgggacgctcgtgtatctg
gccggattcgccctgctggtctggtcggagtcgatcgtgcgcaatctgcgggacaagaaa
aacccgggtgccaccgagtaccagatcccctacggcggcgggttccggttcgtcaccagt
cccgcgtacttgggcgagctgatcgcctgggccgggttcgccctgctgacctggtcgctg
gccggggttgccatctttgcgatcacggcaggcaatctggttccacgagcgttcgccacg
cagaagtggtaccgcgagaagttccccgactaccccgccgagcgaaaagccttgataccc
ggggtgatctga

DBGET integrated database retrieval system